SecReT4
Protein ID: 50119517
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0568
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]631392..632048 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDQ6D9P7
KEGG IDeca:ECA0568
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3.7e-93, Aligned region: 5..203
Protein Sequence: 218 a.a.     [Download]
>gi|50119517|ref|YP_048684.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSIYRNAVRNRDQHILTLRIACGVLVVLLLVTILGWMRAPSNLTVHNPPDLRAGSTKPWWEVPAPTVYSF
AFYIFQQLNAWPKNGEQDYPGKIFSLSPYLTPSCLDFLNADAKKRSLGNELLDRVRVVYEIPGRGYSAES
VDVISRDNWVVRLDLVTDEYYHTEPVKRVLVRYPLKVVRWDGDAERNPFGLALDCYDAMPQRLEISHQPQ
PEKKGIMQ
 
Nucleotide Sequence: 657 bp     [Download]
>gi|50118965|ref|NC_004547.2|:631392-632048 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAGCATCTACCGTAACGCGGTAAGAAATCGCGACCAACATATCCTGACATTACGCATTGCCTGTGGCG
TTCTGGTAGTTCTGTTACTGGTCACGATACTTGGCTGGATGCGGGCACCTAGCAATTTGACGGTTCACAA
TCCTCCAGATCTCCGGGCTGGTAGTACCAAGCCCTGGTGGGAAGTGCCGGCACCTACAGTCTATAGCTTT
GCGTTCTACATTTTCCAGCAGTTGAATGCCTGGCCGAAAAATGGCGAACAGGACTACCCCGGCAAGATAT
TCAGCCTATCCCCGTACCTGACGCCATCTTGTCTGGATTTTCTGAATGCAGACGCGAAAAAACGCTCATT
GGGTAATGAGTTACTGGACCGCGTTCGTGTGGTTTACGAGATACCCGGGCGTGGGTACAGCGCGGAGAGT
GTAGATGTTATCAGCCGTGATAACTGGGTTGTCCGTCTGGATCTGGTGACTGATGAGTATTATCACACCG
AACCTGTCAAACGCGTACTGGTGCGTTACCCGCTAAAAGTCGTTCGCTGGGATGGGGATGCTGAACGTAA
CCCGTTTGGCCTGGCACTGGATTGTTATGACGCTATGCCACAGCGTTTGGAAATTTCACATCAGCCTCAG
CCAGAGAAAAAGGGGATTATGCAGTGA
 Primer design