SecReT4
Protein ID: 50119518
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0569
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]632045..632971 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ6D9P6
KEGG IDeca:ECA0569
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 3.9e-113, Aligned region: 17..298
Protein Sequence: 308 a.a.     [Download]
>gi|50119518|ref|YP_048685.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MKVKPSTARWFFHRGLLAFLMTVSWHAAADELIKWERIPLQIPLKVGQERVIFADKNVRVGFPPALNDKL
RVQSTGGAVYLKADSAFPQTRLQLQDLESGEIILLDVTASLNGPTEPIRLVYSGDVTTVDNSDRPAKSSE
RSSSSSASETKLDAKAPKTPRYNAPLPVVLTRFAAQTLYGPLRAVEPVSGIHPVNPRISGKITTLYPSEP
FDITTLSAWGVGARSVVALRIRNTSSRKVVLDPRILQGQFVSATFQHRWVGPIGTPEDTTTLYLVTDSRP
ELAFFAEPVAKMSSASGKASKKERAHAN
 
Nucleotide Sequence: 927 bp     [Download]
>gi|50118965|ref|NC_004547.2|:632045-632971 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
GTGAAAGTGAAACCTTCCACAGCACGATGGTTTTTTCATCGCGGGTTACTGGCATTTCTCATGACCGTAT
CGTGGCATGCCGCTGCTGACGAATTAATTAAATGGGAACGCATCCCCCTACAGATCCCACTAAAGGTAGG
GCAAGAACGCGTTATTTTTGCGGATAAAAATGTTCGTGTCGGTTTCCCGCCGGCACTGAATGACAAGTTA
CGCGTGCAATCGACCGGTGGCGCAGTTTATCTCAAAGCGGACAGTGCATTTCCTCAAACGCGGTTGCAGT
TACAGGATTTGGAAAGCGGCGAGATTATTCTGCTCGACGTGACTGCGTCATTGAATGGCCCGACGGAGCC
TATCCGCCTGGTGTACAGCGGTGATGTGACCACGGTTGATAATAGCGACCGTCCAGCCAAATCATCTGAG
CGTAGTAGCTCATCCTCTGCTTCGGAAACGAAGCTAGACGCGAAAGCGCCTAAGACTCCCCGCTATAACG
CACCCTTGCCCGTCGTTCTGACCCGTTTTGCCGCGCAAACACTCTACGGTCCTTTACGTGCGGTAGAGCC
AGTGAGTGGTATTCATCCCGTTAATCCTCGGATATCTGGGAAGATCACGACGTTATACCCCTCTGAACCG
TTTGATATTACCACGCTGTCAGCCTGGGGCGTTGGGGCGCGCTCCGTTGTAGCCCTGCGTATTCGCAATA
CATCAAGTCGAAAGGTCGTTCTCGATCCCCGGATTCTTCAGGGGCAGTTTGTTTCTGCCACGTTCCAGCA
TCGTTGGGTCGGGCCAATAGGCACACCAGAAGACACGACAACATTGTATCTGGTAACCGATAGCCGTCCG
GAACTGGCATTTTTCGCAGAGCCGGTCGCCAAAATGAGTTCGGCATCAGGTAAGGCCAGTAAGAAGGAGC
GTGCTCATGCAAATTAA
 Primer design