SecReT4
Protein ID: 50119519
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0570
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]632961..634493 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ6D9P5
KEGG IDeca:ECA0570
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 510 a.a.     [Download]
>gi|50119519|ref|YP_048686.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MQIKSNTLVKVIVPSVLAIGALIGVKSCQSPDQAQSTADTAKTTLGLSQDELKALGVAGDTPEDTLRTVV
GSLNQVRSDLGKLSQQNEDLKKQNDVLTRRSTDVSGQVNEAVSGVQQSYDTQQKRLQDEQLRIQNKIQEL
TDKLANTMSNPGGHISGGSNYLGSSGHGDIPLGLGLDGMGSGTTGTQSQGADGLIWVQPKDQKPTDPNKT
SSAGMPALPQFPTSFLNDNELTRQKAAYEQQVKGYSNEKNEVTAEPVYTLPENSTLIGSRAMTALLGRVP
INGTVTDPYPFKVLIGKDNLTANGVDLPDVEGAIVSGTASGDWTLSCVRGQVNSITFVFSDGTVRTLPRA
NANSNGSSSGNDQGASGANGGIGWISDEAGIPCISGERKSNASTYLPTIFALSAGSGAASALSQNQQTTQ
ANGYGGMTSSLTGDAGQAVLGKALAGGLNETTDWVKQRYGQTFDAIYVPPGMRLAVHITKQLAIDYEDKG
RKVRYDFSLPADGGSQRGLD
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|50118965|ref|NC_004547.2|:632961-634493 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCAAATTAAGTCCAATACGCTGGTCAAAGTGATTGTGCCATCGGTACTGGCCATCGGTGCATTGATTG
GCGTAAAGAGTTGCCAGAGTCCGGATCAGGCGCAGAGTACTGCTGATACCGCTAAGACGACGCTGGGATT
ATCTCAGGATGAACTTAAAGCGTTAGGCGTCGCCGGCGATACGCCAGAGGATACGTTACGTACGGTTGTT
GGCTCGTTGAACCAGGTACGCAGTGATTTGGGCAAGCTCAGCCAACAAAATGAGGACCTGAAAAAACAAA
ATGATGTGTTGACCCGACGTAGTACCGATGTATCCGGACAAGTGAATGAGGCCGTTTCAGGTGTGCAACA
GTCCTACGACACGCAACAAAAGCGCTTACAGGATGAGCAGTTACGGATACAGAATAAAATCCAGGAACTG
ACCGATAAACTGGCTAATACGATGAGTAATCCCGGTGGCCATATTAGCGGAGGGAGTAACTACCTGGGAT
CCTCAGGGCACGGTGATATCCCTCTGGGGTTAGGGTTGGACGGCATGGGAAGTGGTACCACTGGCACCCA
GTCACAAGGTGCAGATGGCCTGATATGGGTACAACCAAAAGACCAGAAGCCAACGGATCCTAATAAGACT
TCCAGTGCTGGCATGCCAGCGCTCCCTCAGTTTCCTACCTCCTTTCTTAACGACAATGAGCTAACGCGCC
AGAAAGCGGCGTATGAGCAACAGGTGAAAGGGTACTCGAACGAAAAAAATGAGGTTACAGCAGAGCCCGT
TTACACCTTACCAGAAAATTCCACGCTGATCGGCAGCCGGGCAATGACGGCGCTGTTGGGGCGCGTTCCG
ATTAACGGCACGGTGACTGACCCCTATCCCTTCAAGGTACTCATTGGTAAAGACAACCTGACCGCAAATG
GCGTTGACTTACCTGATGTTGAAGGTGCGATCGTATCAGGTACTGCCAGTGGTGACTGGACGTTGTCGTG
CGTTCGTGGCCAGGTCAATAGTATTACGTTTGTGTTTTCCGATGGTACCGTTCGCACATTGCCGCGTGCC
AACGCCAACAGCAATGGCAGTAGTAGCGGCAATGATCAAGGTGCAAGTGGCGCTAATGGTGGTATTGGCT
GGATTTCTGATGAAGCGGGGATCCCGTGCATCAGTGGCGAGCGAAAATCTAACGCATCTACCTATCTGCC
CACCATTTTTGCCCTCTCTGCTGGATCTGGGGCAGCCAGCGCGTTGAGCCAGAATCAGCAAACGACGCAA
GCAAATGGTTACGGTGGGATGACGTCCTCACTCACGGGAGACGCAGGGCAGGCCGTCCTTGGCAAAGCGC
TGGCCGGTGGCCTGAATGAGACGACTGACTGGGTGAAACAGCGCTACGGGCAGACATTTGATGCGATTTA
TGTCCCGCCTGGCATGCGATTAGCCGTGCATATTACGAAGCAACTGGCGATTGATTACGAAGATAAAGGT
CGCAAGGTTCGGTATGACTTCTCGTTGCCGGCTGATGGTGGCAGTCAACGTGGTTTAGATTAA
 Primer design