SecReT4
Protein ID: 50119521
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0572
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]634939..635349 [+]
Productlipoprotein
Component typeTfc15
UniProt IDQ6D9P3
KEGG IDeca:ECA0572
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 136 a.a.     [Download]
>gi|50119521|ref|YP_048688.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MPKYQIMATLLVIALLSGCSTSKEEMLPAGEHSMLELWNGADGEGTTRRSAQAREALRRPLSTGENQASL
HDDRSYSRTQESEISQQFPRLPNPDMVIYIFPHLTEGSTPVPGYSTVFPFYSQTQYAMPGERVEAL
 
Nucleotide Sequence: 411 bp     [Download]
>gi|50118965|ref|NC_004547.2|:634939-635349 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCCTAAATACCAGATTATGGCCACGCTGCTGGTCATCGCGCTCTTGAGCGGATGCTCGACCTCAAAAG
AAGAAATGCTGCCGGCTGGAGAACACTCCATGTTGGAGTTATGGAATGGCGCAGATGGAGAAGGAACTAC
TCGACGTTCTGCTCAGGCCCGAGAGGCATTACGCCGACCGCTGAGTACCGGGGAGAACCAGGCGTCTTTA
CATGACGATCGGAGCTACAGTCGCACTCAGGAGAGTGAAATCAGCCAACAGTTCCCCCGTCTGCCGAATC
CAGACATGGTGATATACATTTTCCCTCATTTGACGGAGGGCAGTACACCCGTTCCCGGGTACAGCACGGT
CTTTCCGTTCTATAGCCAGACTCAGTATGCGATGCCGGGTGAACGCGTGGAGGCGCTGTAA
 Primer design