SecReT4
Protein ID: 50119522
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0573
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]635349..638210 [+]
Productplasmid-like protein
Component typeTfc16
UniProt IDQ6D9P2
KEGG IDeca:ECA0573
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.4e-63, Aligned region: 58..327
AAA_10 [PF12846], Evalue: 1.8e-41, Aligned region: 520..865
Protein Sequence: 953 a.a.     [Download]
>gi|50119522|ref|YP_048689.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MFSLFNKKRLSRSREIRVPDDAIGSLAEGISIQVAGRASLQRPGKMTIQDEVKLNHANPSIIDYLPWAEF
LDSDKCLLLDDGISVGAVYEVSPVATEGRTEARLEQIRDTVEDAIQDSFEELDENPWVVQFFCQDENNVD
TYVDRLRGYVKPHAQGTPFSEAWLKETERHLRGIARSEGLFTDTKITGQPWRGQQRRTRMVIYRWIGKNN
RDPMPPIAMLNQVCERVTSALSGAGVMCVRQNGHQVHGWLLRHFNPSPEWVDKDTLYRQAAYFDRRDTPD
GTMPVLNDFTETLWFNPPRSDVENGVWWFDNQAHCALPVEKLRRPPKPGAITGEMLRGEKINALMDLFPE
GSTLCMTIVVQPQDKLEADFTRLAKNAVGENTESGRVRQDVKTVKEYLGNRHKLYRAGLTFLLRADDVET
LNHKCVELTTVLLGAGLQPVRPEYDVAPLNTYLRALPMCFNPETDKKHWYTRLTWVQHLAGLLPVTGRET
GTGNPGISFFNRGGDVFSFDPLNKGDRSQNAHKLIFGPTGAGKSATMCAMLSQVMAIHRPRLFIAEAGNS
FGLLADYFESLGLTVNKVSIKPDSGLSLPLFGDAYQLLNSDVPLAIDADALPELDADSEDPDDEKEDNKE
KQKRDILGEMEISARMMITGGDTKEEAELKRADRAMIREALIMAAKAAYAASEQMLPSHLQRALLNISMD
TERNEQRRTKAAEMAESLSMFTQEGSFEAELFNREGQLWPEADVTLIDLGYFAREGYEAQMALTMVSLTN
TVNNIAERDQYKKRDIVFAIDEAHIATVNPLLAPYMTKIVKMWRKLGAWLWLATQNLEDFPDAAGKMLNM
AEWWLCLVMPKKEVDDISRFKSLTDEQKSVLMSASKLDKCYTEGVVLSKNVQALFRAVPPSLYLALGMTE
KEEKVERRRLMNEFHCSELEAAMRVATALDNARGLVEQEKAAV
 
Nucleotide Sequence: 2862 bp     [Download]
>gi|50118965|ref|NC_004547.2|:635349-638210 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTTCTCACTATTTAATAAAAAGCGCCTATCCCGCTCTCGGGAAATTCGTGTACCTGATGACGCAATCG
GCAGTCTTGCTGAAGGTATTTCAATTCAGGTTGCCGGACGAGCATCACTGCAACGTCCCGGGAAGATGAC
GATCCAGGATGAGGTAAAGCTCAATCATGCTAATCCCTCAATCATCGATTACCTGCCGTGGGCAGAGTTC
TTAGACAGTGATAAATGCCTGTTGTTGGATGATGGCATTTCTGTCGGAGCGGTATATGAAGTCTCTCCCG
TTGCGACAGAAGGACGTACGGAAGCGCGCCTGGAACAAATCCGCGATACGGTCGAGGATGCGATACAGGA
CAGCTTTGAAGAACTGGATGAAAACCCCTGGGTTGTGCAGTTCTTTTGTCAGGATGAGAACAATGTCGAT
ACTTATGTCGATCGCCTGAGGGGCTATGTCAAACCCCATGCGCAGGGCACACCGTTCTCGGAAGCCTGGC
TGAAAGAGACCGAGCGACATTTACGGGGGATTGCCCGTTCTGAAGGACTGTTTACTGACACCAAAATTAC
TGGCCAGCCCTGGCGCGGTCAGCAGCGTCGTACGCGCATGGTGATATACCGCTGGATTGGTAAAAACAAC
CGAGACCCGATGCCGCCGATCGCTATGCTCAACCAGGTATGTGAACGTGTGACCAGTGCATTGTCTGGTG
CTGGGGTAATGTGTGTGCGACAGAATGGCCATCAGGTACATGGCTGGTTGCTGCGTCATTTTAATCCGTC
GCCGGAATGGGTGGATAAAGACACGTTATATCGTCAGGCAGCCTATTTTGACCGACGCGATACACCTGAT
GGCACCATGCCGGTACTCAATGATTTTACGGAAACGCTATGGTTCAACCCGCCACGTTCGGACGTGGAGA
ACGGCGTATGGTGGTTTGATAATCAGGCGCATTGTGCGTTGCCGGTCGAGAAATTACGGCGCCCGCCAAA
ACCCGGAGCGATTACAGGGGAAATGCTCCGGGGGGAGAAGATCAATGCGTTAATGGACCTCTTTCCGGAG
GGCAGCACCCTGTGTATGACCATTGTGGTACAGCCACAAGATAAGCTGGAAGCCGATTTTACCCGACTAG
CGAAGAATGCCGTAGGGGAGAACACCGAGTCTGGCCGTGTTCGCCAGGATGTCAAAACCGTCAAAGAGTA
TCTGGGTAACCGGCATAAGCTGTACCGTGCTGGGCTGACGTTTTTGCTGCGCGCTGATGATGTGGAAACG
CTCAATCATAAATGCGTAGAGCTGACGACGGTGTTGCTAGGTGCTGGCTTGCAGCCAGTGCGGCCGGAGT
ATGACGTTGCACCACTGAACACCTATTTGCGGGCATTACCTATGTGTTTTAACCCGGAGACGGATAAGAA
ACACTGGTATACACGGCTAACGTGGGTACAGCATCTGGCAGGGTTATTGCCTGTAACGGGCCGAGAAACC
GGTACGGGTAATCCCGGGATCAGCTTTTTCAATCGCGGGGGCGACGTATTTTCATTCGATCCGTTGAATA
AAGGCGATCGCAGCCAAAATGCACATAAGCTGATATTTGGACCGACCGGTGCCGGGAAGTCGGCAACGAT
GTGCGCGATGTTATCGCAGGTGATGGCTATCCACAGACCCCGACTGTTTATTGCTGAAGCCGGCAACTCA
TTTGGGTTATTGGCCGATTACTTTGAAAGTCTGGGGCTGACGGTGAATAAGGTCAGTATCAAACCGGATA
GTGGATTGAGTCTTCCGTTGTTTGGTGATGCTTATCAGTTATTGAACAGTGATGTTCCTCTAGCCATTGA
TGCCGATGCATTGCCTGAGTTGGATGCGGACAGCGAAGATCCAGACGACGAGAAAGAAGATAATAAAGAA
AAACAAAAACGAGATATTTTGGGGGAAATGGAGATTTCAGCCCGCATGATGATTACTGGCGGGGATACGA
AAGAAGAGGCTGAGCTGAAGCGCGCCGATAGGGCGATGATCCGTGAAGCCTTAATTATGGCGGCTAAAGC
TGCCTATGCGGCTTCAGAACAAATGCTACCTTCTCATTTGCAACGTGCATTACTCAATATTTCCATGGAT
ACCGAACGTAATGAACAGCGTCGGACTAAAGCCGCAGAGATGGCCGAATCGTTAAGCATGTTCACACAAG
AGGGGAGTTTTGAAGCGGAACTATTTAACCGTGAGGGGCAGCTCTGGCCAGAAGCTGATGTGACGCTGAT
TGACCTGGGCTATTTTGCGCGTGAAGGGTATGAAGCGCAGATGGCGCTGACGATGGTGTCACTGACTAAC
ACCGTTAACAATATTGCTGAACGCGACCAGTACAAGAAGCGAGACATCGTATTTGCCATCGATGAGGCAC
ACATTGCAACCGTGAATCCGCTTCTGGCGCCATATATGACCAAGATCGTCAAAATGTGGCGAAAACTGGG
TGCCTGGCTCTGGCTGGCAACGCAGAACCTGGAGGATTTCCCTGACGCTGCCGGCAAAATGCTTAACATG
GCTGAATGGTGGCTATGTTTGGTTATGCCGAAGAAAGAGGTCGATGATATCAGCCGCTTCAAGTCCCTGA
CCGATGAACAGAAATCGGTGTTGATGTCGGCCAGCAAGCTGGATAAATGCTACACCGAGGGCGTCGTATT
ATCGAAGAACGTCCAGGCATTGTTCCGTGCCGTTCCCCCCAGTTTGTATTTGGCGCTCGGTATGACAGAA
AAAGAAGAAAAAGTGGAACGACGTCGTTTGATGAATGAATTCCATTGTTCGGAGCTGGAAGCGGCAATGC
GGGTCGCCACAGCATTAGATAACGCCCGTGGTTTGGTTGAGCAGGAGAAAGCTGCAGTATGA
 Primer design