SecReT4
Protein ID: 50119525
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0576
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]639329..639733 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ6D9N9
KEGG IDeca:ECA0576
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 5e-38, Aligned region: 19..124
Protein Sequence: 134 a.a.     [Download]
>gi|50119525|ref|YP_048692.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MCSKIAVFLFLLSPAPLLANPVVYTDQQHPPTNLTPETQIVWLDAPERLQRSVFGEFPASMEQATVQAQV
VMRSPKWQQHENDLQTAYRGVVHAWEIGVRKYPAVVFDDRDVVYGTADVAMAIAYKMQEGGSHE
 
Nucleotide Sequence: 405 bp     [Download]
>gi|50118965|ref|NC_004547.2|:639329-639733 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTGCAGCAAAATAGCCGTTTTTCTTTTTTTACTCTCACCTGCGCCATTACTGGCCAATCCCGTTGTTT
ATACCGACCAGCAACATCCTCCTACCAATCTTACCCCCGAGACTCAGATAGTCTGGCTGGATGCTCCGGA
ACGGTTGCAGCGTTCCGTGTTTGGCGAGTTTCCCGCATCGATGGAACAAGCGACAGTACAAGCTCAGGTT
GTTATGCGCTCCCCGAAGTGGCAACAGCATGAGAATGACCTGCAAACGGCCTATCGTGGTGTGGTGCATG
CATGGGAAATTGGCGTGCGCAAATATCCTGCTGTTGTTTTTGACGATCGCGACGTGGTGTACGGTACTGC
TGATGTTGCCATGGCTATCGCATATAAAATGCAAGAAGGGGGTAGCCATGAGTAA
 Primer design