SecReT4
Protein ID: 50119526
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0577
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]639726..640700 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ6D9N8
KEGG IDeca:ECA0577
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.3e-96, Aligned region: 33..313
Protein Sequence: 324 a.a.     [Download]
>gi|50119526|ref|YP_048693.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSKWRTRLRPLAVGIMLTTACEPAAIAAVNTAQIVASAISPGCISWRVSGICYWLFCTNFGCTIRTSVKV
SHFIPDAVVSTYMAPGGNPWSEMSPVSQGAGGLESTITSGLTGVTAGGGNAADIKDPGRRKSNIKFKYAD
AIGHPASTLIGGQIPGYSCDSVATPLMPYFLSTLDSLAWRTGIPESLYPEALIPGQREVGSMASGNMWGN
VYPRSGFIQHTDDDKASAVVAQRVADIITRSGQLHVYQPLTGSRRDGYWPPEPVVENTNNHKWQRLSPQL
TSSCAVFPDGDHMSAENGNAAYALWQPYSCCQRRGQRLLSATNF
 
Nucleotide Sequence: 975 bp     [Download]
>gi|50118965|ref|NC_004547.2|:639726-640700 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAGTAAATGGCGAACCCGACTCCGTCCACTTGCTGTTGGCATTATGCTTACGACGGCATGTGAGCCTG
CCGCTATTGCTGCCGTTAATACCGCGCAGATTGTTGCCAGCGCTATTTCGCCTGGATGTATCAGTTGGCG
TGTCAGTGGCATTTGTTACTGGCTGTTCTGCACGAATTTCGGTTGCACCATACGAACGTCCGTCAAGGTG
TCCCACTTTATTCCCGATGCGGTCGTGTCCACATATATGGCTCCAGGAGGTAACCCCTGGTCAGAAATGT
CTCCAGTAAGCCAAGGTGCGGGAGGGTTGGAAAGTACGATTACCAGTGGATTAACTGGAGTTACTGCCGG
TGGTGGTAACGCAGCAGACATTAAGGATCCTGGACGAAGAAAATCCAACATCAAATTTAAGTATGCGGAT
GCGATAGGTCACCCAGCCTCGACACTTATCGGTGGACAAATTCCCGGTTATTCCTGCGACAGTGTCGCCA
CACCGCTCATGCCGTATTTTCTGAGCACGCTAGATTCTCTCGCCTGGCGAACGGGAATTCCTGAATCACT
GTATCCAGAGGCACTCATTCCCGGCCAGCGTGAAGTCGGTAGCATGGCATCAGGAAATATGTGGGGGAAT
GTTTATCCCCGCTCTGGATTTATCCAGCATACCGATGACGATAAAGCGTCAGCCGTAGTCGCCCAGCGCG
TGGCGGACATTATTACGCGTTCTGGCCAACTGCACGTCTATCAGCCCCTGACAGGCTCCCGCCGTGATGG
GTACTGGCCCCCCGAACCTGTCGTGGAAAACACCAACAATCACAAGTGGCAGCGTTTGTCTCCACAGCTA
ACGTCCTCATGCGCCGTATTCCCTGATGGTGACCACATGTCAGCTGAAAATGGCAATGCAGCCTATGCCC
TTTGGCAGCCCTACAGTTGCTGCCAACGTCGTGGTCAGCGGTTGTTATCTGCCACTAATTTTTAA
 Primer design