SecReT4
Protein ID: 50119527
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0578
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]640710..642134 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ6D9N7
KEGG IDeca:ECA0578
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 474 a.a.     [Download]
>gi|50119527|ref|YP_048694.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MNMKFCVLAIGLQWVTPCVLADQFNVNLPQANSGALGYGADVSGAVSDKLFYTLGGGSVISQPATRISMQ
KLGVDLGWSSDLQCGNFDLKTTVGNQLNGVTSGYKNLMGEVIQGATGAVSSLPGAIIQRASPGLYDMLTN
GVLQANVAFDKAMFNCQNMTKRMMDFSDSSKWTQSAQADEYKQLVNSGKADAIQTDNDSQKLTGNNGQNW
IGGQRRGGKGQPAIRPTHDLAAAGYNMMNSQPALSTSSVSTSNCTGSVCQKFPNSEEAAKAVVQVLGDRS
MRTCKVATDCTSGDEGQQPGTTQAGTGFAPMLEEATKANLEQLVKMVNGAEKPTAANLGKLKAGSLTITS
GVIRALQRDPDNAALTGRLASELAMADTVETALLMRRMLMTGMSEPNAAAQEAAVDEGTRRIESLDREIN
ALKNEMELKRELARNSVLTIIERENSRVETNPQKQIQDNTDMRVNQMTTPVQGK
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|50118965|ref|NC_004547.2|:640710-642134 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAACATGAAATTTTGCGTGTTGGCTATTGGTCTGCAATGGGTTACGCCGTGCGTTCTGGCCGATCAGT
TCAACGTCAATTTACCCCAGGCGAACAGCGGAGCGCTGGGGTATGGGGCTGATGTCAGTGGTGCTGTGTC
AGATAAACTCTTTTATACGCTCGGTGGCGGTTCTGTGATTTCGCAGCCGGCAACGCGTATCAGTATGCAG
AAGCTGGGTGTTGATCTCGGTTGGAGTTCTGATTTGCAGTGTGGCAATTTTGACCTGAAAACGACGGTCG
GCAATCAGTTGAATGGCGTGACATCCGGATACAAAAACCTGATGGGGGAAGTCATTCAGGGGGCGACCGG
TGCGGTCTCCAGTTTACCTGGTGCCATTATTCAACGAGCGAGCCCGGGACTCTATGACATGCTGACTAAC
GGTGTTCTCCAGGCAAATGTCGCATTTGATAAGGCCATGTTTAACTGCCAAAACATGACTAAACGGATGA
TGGATTTTTCGGATTCCAGCAAATGGACGCAATCCGCACAGGCAGATGAATACAAGCAACTGGTTAATAG
CGGAAAAGCGGACGCCATTCAAACGGATAACGACTCCCAAAAACTGACTGGCAATAACGGCCAAAATTGG
ATTGGTGGTCAGCGACGTGGCGGTAAAGGGCAGCCAGCTATTCGCCCAACACACGATTTGGCCGCAGCCG
GTTATAACATGATGAATAGCCAGCCGGCGTTGAGTACATCTTCCGTCAGTACCAGCAATTGCACTGGCTC
AGTCTGTCAGAAATTCCCTAACTCGGAGGAAGCCGCAAAAGCTGTCGTCCAGGTGCTTGGCGATCGCTCG
ATGCGGACGTGTAAGGTTGCCACTGACTGCACCAGTGGGGATGAAGGCCAACAACCCGGAACTACTCAGG
CGGGAACCGGGTTTGCCCCCATGTTGGAAGAGGCAACGAAAGCCAATCTTGAACAACTGGTGAAAATGGT
TAATGGGGCAGAGAAACCTACCGCGGCGAACCTGGGCAAATTGAAAGCTGGGAGCCTGACTATCACCAGT
GGTGTTATCCGGGCATTACAACGTGATCCAGATAACGCTGCATTGACTGGTCGGTTGGCCAGCGAACTGG
CGATGGCGGATACGGTCGAGACGGCCTTACTGATGCGACGCATGCTGATGACCGGAATGTCTGAGCCAAA
TGCTGCCGCTCAGGAGGCTGCGGTTGATGAGGGAACTCGTCGTATTGAATCGCTCGATCGGGAAATTAAT
GCGCTAAAGAATGAGATGGAACTCAAACGCGAGCTGGCACGTAACTCGGTACTGACCATCATTGAGCGGG
AAAATAGCCGCGTAGAAACCAATCCGCAGAAGCAAATCCAGGACAACACGGATATGCGCGTCAATCAGAT
GACTACCCCTGTTCAGGGTAAATAA
 Primer design