SecReT4
Protein ID: 50119529
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0580
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]642505..644037 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ6D9N5
KEGG IDeca:ECA0580
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1e-124, Aligned region: 8..485
Protein Sequence: 510 a.a.     [Download]
>gi|50119529|ref|YP_048696.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MTTNSYFEYFLTLLGWVINNGLWNILIGTGLFAAPLAFKIVGIWMKVREEGEDEGNKGMLSLPRIENALY
GGFFVMLACCVPLINLSLSTMQYDTSRAKTCGTWTPLSPDESGYSSVVSSLNDQTAAVPFWWAVVHRLSK
GVTQAAVATIPCRPDLRQVRFEVQRTNISNPALAEELQDFTNDCYALALYTWKQQDQGATTDKDVLKDIE
WLGSSTFRSRYYGELNSKMPRSNFPWSDARDSGRPNTGRGGYPTCNEWWSTADTGLQDRVVNQADPGMWL
RLSAALKMMGKSTADYKEAVIRRLVSPQSLNISQGGQVYAGYGGNADFTTMNTVNRFGAIAGGALGSLGA
FPAFDAMRQALPMVQAILLMAIYVMLPLILAFGVYEFKVVITLTFVIFALNFLTFWWELARWLDSWLLEA
LYSSDTHSRFNLAGFQNTSDDLVMTFVMGTMFIVLPAVWVGSLSWAGRDIGAALSNAIGSGVKDARVSAS
SAGDAASGAIKQAATNRLSK
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|50118965|ref|NC_004547.2|:642505-644037 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGACCACAAACAGCTATTTCGAGTATTTTCTGACGCTACTGGGTTGGGTCATTAATAATGGCCTGTGGA
ACATCCTGATTGGTACCGGACTATTTGCTGCACCTTTGGCCTTTAAAATAGTTGGTATTTGGATGAAGGT
CCGAGAAGAAGGAGAGGACGAAGGAAACAAAGGAATGCTATCGCTACCCCGCATCGAAAACGCACTGTAC
GGTGGGTTCTTTGTGATGTTGGCCTGCTGCGTTCCGTTGATTAATTTGAGCCTGAGTACCATGCAGTACG
ATACGTCTCGAGCGAAAACGTGTGGAACCTGGACACCATTGTCTCCGGATGAAAGTGGGTATTCGAGCGT
AGTGTCCAGCCTTAATGATCAGACTGCTGCGGTACCCTTTTGGTGGGCCGTTGTACACCGCCTGTCAAAA
GGGGTAACACAGGCTGCCGTCGCGACCATTCCTTGTCGCCCGGATTTGCGCCAGGTTCGTTTTGAGGTGC
AGAGAACCAATATCAGCAATCCGGCGTTGGCTGAAGAGCTTCAGGACTTTACCAACGACTGTTATGCGCT
CGCGTTATATACGTGGAAACAGCAAGATCAGGGAGCCACAACGGATAAGGATGTGCTGAAGGACATTGAA
TGGTTAGGCAGTTCAACGTTTCGTTCCCGTTATTATGGTGAACTGAACTCAAAAATGCCGCGGTCAAATT
TTCCCTGGAGCGATGCCAGGGACAGTGGGCGGCCGAATACGGGGCGGGGGGGGTATCCTACATGTAATGA
ATGGTGGTCCACAGCGGATACCGGTTTGCAGGATAGGGTAGTCAATCAAGCTGACCCAGGCATGTGGCTG
CGTCTTTCTGCCGCACTGAAAATGATGGGGAAAAGCACGGCTGACTACAAAGAAGCAGTGATCAGGCGAC
TGGTGAGTCCTCAGAGCCTAAATATCTCTCAGGGAGGGCAGGTTTATGCGGGCTACGGAGGTAATGCGGA
CTTCACCACGATGAATACCGTCAATCGGTTTGGTGCTATTGCCGGCGGCGCGTTGGGAAGCCTGGGAGCA
TTTCCGGCATTTGATGCGATGCGCCAGGCGCTACCAATGGTTCAGGCTATTTTATTGATGGCTATCTACG
TCATGTTGCCGCTGATCCTTGCGTTTGGTGTCTATGAATTCAAGGTCGTGATTACCCTAACGTTCGTGAT
ATTCGCGCTGAATTTCCTGACGTTCTGGTGGGAACTGGCTCGGTGGCTCGACAGTTGGCTACTTGAAGCA
CTGTACAGCTCGGATACCCACAGCAGATTTAATCTGGCAGGGTTTCAAAACACCTCTGACGACCTGGTCA
TGACTTTTGTGATGGGAACAATGTTCATTGTTCTGCCGGCAGTATGGGTAGGATCATTATCGTGGGCAGG
GCGGGATATCGGGGCTGCGTTATCCAACGCAATAGGTAGTGGAGTAAAAGATGCTAGAGTTTCAGCAAGT
AGTGCTGGTGATGCTGCTAGTGGGGCAATAAAACAAGCGGCTACAAATAGGTTATCAAAATAA
 Primer design