SecReT4
Protein ID: 50120542
T4SS name [ID]VirB [411]
Gene symbol-
Locus tagECA1609
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1864495..1866396 [-]
Productmobilization protein
Component typeVirD4
UniProt IDQ6D6S2
KEGG IDeca:ECA1609
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 7.2e-05, Aligned region: 430..508
Protein Sequence: 633 a.a.     [Download]
>gi|50120542|ref|YP_049709.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MGRTADEGGIVILNKLAVSLSPIVNGALSFMAFMQQHQLMLALLSGLTMPFFASMKSDERQKAPLWQKLI
IAFSLLCFLSGTMAPVVIWIFQWLYRGRVIASIPVLAWPVLITFTVTGFILHILLRRVLTPELDKIKKRL
VRKTTLERELRTDVRTVKSLLPETLHYDPLDYIDLNKGIFIGMDRDIQPMYLPLKDWQKQHADIIGTTGA
GKGVATGILLYQSILAGEGVFVMDPKDDEWAPHLYRKACEDAGKTFALIDLRKTQYQLNLIEKITADELE
ELFVAGFSLAEKGQESDFYRIDDRKAARIAAQFVICNTASTIRDIYNGDYVQGIADKIKAFFGKIEELAL
LNAINAPTGFSLNKIFEEGGCCYVIGSMRNSKIITAQRMLLVRLYQLAEKRERVKKVPRPIAIYLSELKY
HLSRPALEGLGAARDKGVHIIMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAEWVARM
SGTILVDDEVRKAKTDAVLTETIDSERTIRQAERFFTDSNMILNLPDFVSFIFTTKTLPSASLISPIRVK
KRELEICAVSPAIAATAATINIALDFNEEETSPRPASTPDITATRSDLFFDTDEKDSTTPNTNKEENPSL
LDF
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1866396-1864495 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGGGCGAACTGCTGACGAAGGAGGCATCGTGATTTTGAATAAGCTGGCCGTTTCACTGTCGCCGATAG
TGAATGGCGCGCTGAGCTTCATGGCTTTTATGCAACAGCATCAGCTGATGCTGGCGCTGTTATCGGGGCT
GACGATGCCGTTTTTCGCATCGATGAAAAGCGATGAACGGCAAAAAGCCCCGTTGTGGCAAAAGCTGATT
ATTGCTTTTTCCCTGCTGTGTTTTCTTTCCGGTACGATGGCCCCGGTTGTTATCTGGATTTTCCAGTGGC
TTTATCGGGGCCGTGTTATCGCCAGCATTCCCGTTCTGGCATGGCCGGTGCTGATTACATTTACCGTAAC
AGGTTTTATTTTGCATATTCTGCTGCGCAGGGTATTAACCCCTGAATTAGACAAAATAAAGAAACGCCTC
GTAAGAAAAACCACGCTTGAACGGGAATTACGCACCGATGTCCGCACGGTGAAATCACTGCTGCCGGAAA
CACTGCATTATGACCCGCTGGATTATATCGACCTGAACAAGGGTATATTTATCGGTATGGACCGCGATAT
TCAACCGATGTACCTGCCGTTAAAAGACTGGCAAAAACAACATGCCGATATTATCGGCACCACCGGGGCC
GGCAAAGGGGTTGCCACAGGGATATTACTTTATCAAAGCATTCTGGCCGGTGAAGGCGTATTTGTGATGG
ACCCCAAGGATGATGAATGGGCACCCCACCTTTACCGTAAAGCCTGCGAGGATGCAGGTAAGACTTTTGC
CTTAATTGACCTGCGAAAAACCCAATACCAGCTAAACTTGATTGAAAAGATCACCGCCGATGAACTGGAA
GAGCTTTTTGTTGCTGGTTTCAGCCTGGCAGAAAAAGGTCAGGAGTCTGACTTTTACCGCATTGACGACA
GGAAAGCAGCCCGGATAGCCGCTCAATTTGTCATCTGTAATACTGCCTCAACCATTCGTGATATCTATAA
CGGAGACTACGTTCAGGGTATTGCCGATAAAATAAAAGCCTTTTTTGGGAAAATTGAAGAGCTGGCCCTG
CTCAATGCCATCAATGCGCCGACAGGATTTTCGCTCAATAAGATATTTGAGGAAGGTGGTTGCTGTTATG
TGATTGGCTCAATGCGCAACAGCAAAATCATTACCGCGCAGCGCATGCTGCTGGTTCGCCTGTATCAGCT
AGCGGAAAAGCGCGAGCGAGTGAAAAAAGTGCCCCGCCCCATTGCAATTTATCTTTCCGAACTGAAATAC
CATTTATCCAGGCCAGCGCTGGAAGGCTTAGGCGCAGCACGCGATAAAGGCGTGCACATTATTATGGACC
ATCAGTCGATTGCCGATTTAAAAGACTGCCCGGCAGATTTGAAAGGTGACGCCGTTGTCGGCGCGGTCGT
TGAGAACGCCAAATTCAAACTGGTTTATCGTGTCATGGACCCGGATACCGCTGAATGGGTGGCAAGAATG
TCAGGGACCATATTAGTCGATGATGAGGTCCGCAAAGCGAAAACCGATGCCGTGCTGACAGAGACTATCG
ACAGTGAGCGCACCATCAGACAGGCCGAGCGTTTCTTTACCGACAGCAATATGATCCTGAACCTACCCGA
TTTTGTCAGCTTCATCTTCACGACGAAAACACTCCCCTCTGCTTCTCTGATTTCGCCCATCAGGGTGAAA
AAACGCGAACTGGAGATCTGCGCCGTGTCGCCCGCAATTGCCGCCACCGCCGCAACAATAAACATCGCAT
TGGATTTTAACGAGGAGGAAACTTCCCCCAGACCCGCATCAACACCGGATATCACAGCAACCCGATCCGA
TCTTTTTTTTGATACGGATGAAAAAGACTCGACAACACCGAATACCAACAAAGAAGAAAACCCGTCATTG
CTGGATTTTTAA
 Primer design