SecReT4
Protein ID: 50120546
T4SS name [ID]VirB [411]
Gene symbolvirB11
Locus tagECA1613
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1867875..1868891 [-]
Productconjugal transfer protein
Component typeVirB11
UniProt IDQ6D6R8
KEGG IDeca:ECA1613
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-48, Aligned region: 17..308
Protein Sequence: 338 a.a.     [Download]
>gi|50120546|ref|YP_049713.1| virB11 gene product [Pectobacterium atrosepticum SCRI1043]
MNAENLSLDFMKNQLFGDFLPTEGLTEIAINRPGELHTKIKGKWQKHDAPVTLRQCYAFANALASWQEDN
IDDTSPVLSATLESGERIQAIMPPACERNTVSITLRKPSFEQKTHQSWIDAGLYNRISGKEQAESKDAEL
ARCYHSGDIPRFMEKAVEYGKTIFIVGETGSGKTTYMKTLLHYIPPHLRLTTIEDNPEIRFYRHANYVHL
FYPADAGEDAIVTPGRLIRANYRMNPDRILLAEIRGREAWDALKIVGSGHEGLITSMHAGSPEECIEGII
DRCYENPNCQNIPFEVLLRKVLKSIDVIVSIDIHGDVRRIGDIYFKPLHLNIMKEIFK
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1868891-1867875 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAACGCTGAAAACCTGTCGCTGGATTTTATGAAAAATCAGCTGTTCGGTGATTTCTTGCCGACGGAGG
GGCTCACTGAAATCGCGATTAACCGACCGGGTGAACTTCACACCAAAATTAAGGGCAAATGGCAGAAGCA
TGACGCTCCTGTCACGCTGCGCCAGTGTTACGCCTTTGCCAACGCGCTGGCATCGTGGCAGGAGGATAAC
ATTGATGATACGTCCCCTGTTCTGTCCGCCACGCTTGAATCCGGCGAGCGCATTCAGGCCATCATGCCCC
CTGCCTGTGAGCGTAACACAGTGTCTATAACGCTGCGTAAACCGTCATTTGAGCAAAAAACGCATCAGTC
GTGGATTGACGCAGGGTTATATAACCGGATATCCGGTAAGGAGCAGGCGGAAAGTAAAGATGCTGAACTG
GCCCGGTGCTACCACAGCGGGGATATTCCCCGCTTTATGGAAAAGGCGGTGGAGTATGGCAAGACGATTT
TTATCGTCGGTGAAACGGGCTCCGGTAAAACCACCTACATGAAAACGCTGCTGCATTATATTCCGCCGCA
TCTCAGGCTGACCACCATCGAGGATAACCCCGAAATCCGGTTTTACCGCCACGCCAATTATGTTCATCTG
TTTTACCCGGCTGATGCCGGAGAGGATGCCATTGTCACCCCCGGCAGACTGATCCGGGCGAATTACCGTA
TGAACCCTGACCGTATTCTGCTGGCGGAAATTCGCGGGCGGGAGGCGTGGGATGCGCTGAAAATCGTCGG
TTCCGGCCATGAGGGACTGATTACATCGATGCACGCGGGCAGCCCGGAAGAATGTATTGAGGGCATTATT
GACCGCTGCTATGAAAACCCGAACTGCCAGAACATTCCATTTGAGGTGCTGTTACGCAAGGTACTTAAGA
GCATCGACGTTATCGTCAGCATTGATATTCACGGTGACGTGCGCCGAATAGGCGATATTTATTTTAAGCC
GCTCCATCTGAATATAATGAAGGAGATATTCAAATAA
 Primer design