SecReT4
Protein ID: 50120547
T4SS name [ID]VirB [411]
Gene symbolvirB10
Locus tagECA1614
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1868881..1870200 [-]
Productconjugal transfer protein
Component typeVirB10
UniProt IDQ6D6R7
KEGG IDeca:ECA1614
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.9e-52, Aligned region: 242..424
Protein Sequence: 439 a.a.     [Download]
>gi|50120547|ref|YP_049714.1| virB10 gene product [Pectobacterium atrosepticum SCRI1043]
MTETPSPEEPEKTTAEREAEARQRARAEMARREPEPPHQSGQPEVTRFRKSSGRRTLIVTLLSLVLLIAL
ALGGDRLLLALKRGDSNAADSSAPPSNGVAQHERKNLGMDSNPFGLFGQHKPEAAADRASQAPAAASASP
EPPLLNKAAALADGLSGTASTTKESNVRTGQNTTGSDPVEPGGTPGDLYAACTSVMTKGKDGRLRCPDAG
NPTPGSAANAEIASPGVAKVTGVRRLGLDPDLYIPVDRYIPCSMMRRFVSDVGGHISCLISEDVYSASNH
VKLIPAGTVARGIYRTGALQHGSSRMFVLWTELRTPEPGSLQIPLTDTDATGPLGETGIAGWIDSHFWER
FGNALMLSTVQDVAAAAADTAPGKDRNTDYTENTRAATAEMAKTALDNSINIPPTMYLNQGDVIGIMTGT
DIDFSSVWQLRLKKRWYER
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1870200-1868881 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGACAGAGACTCCTTCCCCGGAAGAACCGGAAAAGACCACGGCAGAGCGTGAAGCGGAGGCCCGCCAAC
GCGCCCGCGCGGAGATGGCCCGACGCGAGCCGGAACCGCCGCACCAGTCCGGCCAACCTGAGGTGACTCG
TTTTCGAAAGTCCTCCGGTCGCCGCACGCTAATCGTCACCCTGCTGAGCCTGGTCCTGCTGATTGCGCTA
GCACTCGGCGGCGATCGCCTTCTGCTGGCGTTGAAACGAGGTGATAGCAACGCGGCAGACTCCTCGGCGC
CGCCGTCAAACGGCGTGGCACAGCATGAGCGCAAAAACCTCGGTATGGACAGCAACCCGTTCGGCCTGTT
CGGCCAGCACAAGCCGGAAGCGGCAGCAGACCGGGCAAGTCAGGCCCCCGCCGCTGCGTCAGCATCACCG
GAACCGCCCCTTTTGAACAAGGCGGCGGCGCTGGCTGACGGGCTGAGCGGCACAGCCAGCACGACCAAAG
AAAGTAACGTTCGGACAGGGCAAAACACAACAGGCAGCGACCCGGTGGAACCCGGCGGCACGCCGGGTGA
CTTATACGCCGCGTGTACATCAGTGATGACCAAAGGTAAAGATGGCCGGTTGCGCTGCCCGGACGCCGGG
AATCCAACTCCCGGTTCGGCTGCGAATGCTGAAATCGCCAGTCCGGGCGTAGCGAAAGTGACCGGCGTCA
GGCGGCTGGGGCTCGATCCCGATCTGTATATTCCCGTTGACCGCTATATTCCCTGCTCAATGATGCGGCG
CTTCGTTTCCGACGTGGGCGGCCATATCTCCTGCCTTATCAGCGAGGATGTCTACAGCGCCAGCAATCAC
GTGAAGCTTATACCGGCGGGCACCGTCGCCCGGGGCATTTACCGCACCGGGGCGCTGCAGCATGGCAGTA
GCCGGATGTTTGTGCTGTGGACGGAACTGCGCACGCCTGAGCCCGGCAGCCTGCAAATCCCGCTGACCGA
TACAGACGCTACCGGCCCGTTGGGTGAGACGGGGATCGCAGGCTGGATTGATAGCCATTTCTGGGAACGG
TTCGGCAATGCGTTAATGCTGAGCACCGTGCAGGACGTGGCCGCAGCGGCGGCAGATACGGCACCGGGAA
AAGACCGCAATACCGACTACACCGAAAACACCCGCGCCGCCACGGCGGAAATGGCGAAAACGGCGCTGGA
CAACAGCATCAATATCCCGCCCACAATGTATCTGAATCAGGGTGATGTTATCGGCATCATGACCGGTACC
GATATTGATTTCTCCTCCGTCTGGCAGCTGCGACTGAAAAAGAGGTGGTATGAACGCTGA
 Primer design