SecReT4
Protein ID: 50120548
T4SS name [ID]VirB [411]
Gene symbolvirB9
Locus tagECA1615
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1870197..1871090 [-]
Productconjugal transfer protein
Component typeVirB9
UniProt IDQ6D6R6
KEGG IDeca:ECA1615
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.3e-54, Aligned region: 30..274
Protein Sequence: 297 a.a.     [Download]
>gi|50120548|ref|YP_049715.1| virB9 gene product [Pectobacterium atrosepticum SCRI1043]
MMLKILFSFGLILASCAVWGAATPRGSGYDSRMQNVPYNSQNATVVNTRPGYVTTLLFDDDEVVIDAQAG
FPKGWTVTKSDNRVGVSPNPITQPVTDASGNNVSQVFLPTAQDWKTNLFVVTSKHDYSLELNVLDHDSPA
QAFVIRYHYPAEVRQLSDAASATRLNRLQEAQEKQRIAAAFRQTTAPRNWRYTKRVAAGSASIAPDFTYD
DGRFTYLGFSPTKILPSTFLVVNGQEHAVTPRIVSQGNYTVMVVRALSPDLVLRYGTAVVGIENAAFGKL
AVASGDTVSPHVTLEAK
 
Nucleotide Sequence: 894 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1871090-1870197 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGATGCTGAAAATACTGTTTTCTTTCGGGCTTATCCTCGCGTCATGCGCTGTGTGGGGCGCGGCCACGC
CACGCGGCAGCGGGTACGACAGCCGGATGCAGAACGTCCCTTACAACAGCCAGAACGCCACCGTGGTGAA
TACCCGACCCGGCTACGTTACCACGCTGCTGTTTGACGACGATGAAGTGGTGATTGACGCGCAGGCAGGT
TTCCCCAAGGGCTGGACGGTGACCAAAAGCGATAACCGGGTCGGCGTCAGTCCGAACCCAATAACGCAGC
CGGTCACGGACGCCAGCGGCAACAACGTCAGTCAGGTATTCCTGCCGACCGCACAGGACTGGAAGACCAA
CCTCTTTGTCGTGACGTCAAAGCACGATTACAGCCTGGAGCTGAACGTGCTGGACCACGATTCGCCCGCG
CAGGCGTTCGTTATCCGCTACCACTATCCGGCTGAGGTCCGCCAGCTATCCGACGCGGCCAGCGCCACGC
GCCTGAACAGGCTGCAGGAAGCGCAGGAAAAACAGCGAATAGCGGCGGCATTCAGGCAGACCACCGCGCC
GCGCAACTGGCGTTACACCAAACGGGTGGCCGCCGGTTCGGCGTCGATTGCGCCGGATTTCACTTACGAC
GATGGCCGCTTTACCTACCTTGGTTTTTCCCCCACCAAAATCCTGCCCTCCACCTTCCTGGTCGTTAACG
GTCAGGAACATGCGGTGACGCCCCGAATTGTCAGTCAGGGGAATTACACCGTGATGGTGGTCCGCGCGCT
GTCGCCAGACCTGGTGCTGCGCTACGGCACTGCTGTGGTAGGGATTGAAAACGCGGCCTTCGGGAAATTG
GCGGTCGCCAGCGGTGACACCGTCTCCCCCCACGTCACGCTGGAGGCAAAATGA
 Primer design