SecReT4
Protein ID: 50120549
T4SS name [ID]VirB [411]
Gene symbolvirB8
Locus tagECA1616
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1871087..1871770 [-]
Productconjugal transfer protein
Component typeVirB8
UniProt IDQ6D6R5
KEGG IDeca:ECA1616
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-54, Aligned region: 11..223
Protein Sequence: 227 a.a.     [Download]
>gi|50120549|ref|YP_049716.1| virB8 gene product [Pectobacterium atrosepticum SCRI1043]
MPDVQKIINASRSFESIMLEKEERTRKTAWAMAAVGFTLAGLAIAAVIILLPLKTTEIELWSVDKQTGRY
EYMTRIKERDISTEEALAHSLAAHYVTLREGYNYFSLQRDYDDVQLFNSDSVNKEYLDGFNGDQAPDVIF
HKADYVVSVDTISNVHAPATAPDRLATLRIKRTLRRIADNSVKTDFWNIRLTWRYLPRKQLTDSQREVNP
LGFIVTSYQRDKELRSE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1871770-1871087 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCCTGACGTTCAGAAAATCATCAATGCATCCCGCTCATTTGAATCCATCATGCTGGAAAAGGAGGAGC
GTACCAGGAAGACTGCATGGGCTATGGCGGCGGTCGGATTTACGCTGGCCGGACTGGCGATAGCCGCCGT
GATTATTCTGCTGCCGCTGAAAACCACCGAAATCGAATTATGGTCAGTGGATAAACAGACCGGGCGCTAT
GAATACATGACCCGCATTAAAGAGCGGGATATTTCCACCGAGGAAGCGCTGGCGCATTCGCTGGCGGCGC
ATTACGTCACCCTGCGCGAAGGGTATAACTATTTTTCTCTTCAGCGCGATTACGATGACGTGCAGTTATT
CAACAGCGACAGCGTCAATAAAGAGTATCTGGACGGATTTAACGGTGACCAGGCACCGGATGTCATTTTC
CATAAGGCGGACTATGTCGTTTCTGTCGACACTATTTCCAACGTCCATGCTCCCGCAACGGCTCCCGATC
GCCTGGCCACCCTGCGGATTAAGCGCACCCTTCGCCGCATTGCAGATAATTCGGTAAAAACGGATTTCTG
GAATATCCGCCTGACCTGGCGCTACCTTCCCCGCAAACAGCTGACGGACAGTCAGCGAGAAGTGAACCCG
CTGGGGTTCATTGTCACCAGTTACCAGCGCGATAAAGAACTGAGGAGCGAATGA
 Primer design