SecReT4
Protein ID: 50120550
T4SS name [ID]VirB [411]
Gene symbolvirB7
Locus tagECA1616A
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1871763..1871903 [-]
Productconjugal transfer protein
Component typeVirB7
UniProt IDQ6D6R4
KEGG IDeca:ECA1616A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|50120550|ref|YP_049717.1| virB7 gene product [Pectobacterium atrosepticum SCRI1043]
MKFSIVLLMLCVLAGCAQHKGNLPPVSGSPQSVNSPAIIQELTPNA
 
Nucleotide Sequence: 141 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1871903-1871763 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAAATTCAGCATCGTCCTTCTGATGCTGTGCGTGCTCGCGGGTTGCGCACAGCATAAAGGCAATCTCC
CGCCGGTATCCGGCTCCCCGCAGTCGGTTAATTCCCCCGCCATTATCCAGGAGCTGACTCCCAATGCCTG
A
 Primer design