SecReT4
Protein ID: 50120551
T4SS name [ID]VirB [411]
Gene symbolvirB6
Locus tagECA1617
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1871989..1873029 [-]
Productconjugal transfer protein
Component typeVirB6
UniProt IDQ6D6R3
KEGG IDeca:ECA1617
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.2e-43, Aligned region: 40..259
Protein Sequence: 346 a.a.     [Download]
>gi|50120551|ref|YP_049718.1| virB6 gene product [Pectobacterium atrosepticum SCRI1043]
MSSGIFVGMDKSIMEGLNAVLEGQSSTYGAMTSVIIVSSFTLFIVYRGYQTLGGKLQTPVEDVVWDVGRM
LLITTFVLNRDGWLDASIAAIEGLKDGISGDDNVWALLDTVWEKAQTLGQTLFNLDTSTYVKLNGGLAEV
LVWGGAIVLLLAATFVNLLAEITILLMTTTAPIFIFCLLYGFIKPMFDNWLKTIFTAILTIMFSALSIRI
AINYLNKILDAATQMSNISNMVTLAAQCLLAGIAAGVVVYFSAKIANALSGVAVQAVLQGAAMSGLSGLA
SKSADAARPGMKAGAIGARMTTKGGVVVATAAGRLIAAGTGKAVTAWQKRAAAIESMKRSNQQRNR
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1873029-1871989 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTCCAGTGGTATTTTTGTTGGTATGGACAAAAGCATCATGGAGGGACTCAACGCCGTTTTAGAAGGTC
AGTCTTCCACCTACGGCGCCATGACCAGTGTGATTATCGTCAGTTCCTTCACATTGTTTATTGTGTATCG
CGGCTATCAAACGCTGGGCGGAAAACTCCAGACGCCAGTGGAAGATGTTGTCTGGGATGTGGGACGCATG
TTGCTGATCACCACCTTTGTTTTAAACCGCGACGGCTGGCTGGATGCAAGCATTGCTGCTATTGAAGGGC
TCAAGGACGGGATTAGCGGCGATGATAATGTCTGGGCGCTGCTCGATACCGTCTGGGAAAAGGCACAGAC
GTTGGGACAAACGCTGTTTAATCTGGATACTTCCACTTACGTCAAACTGAACGGTGGGCTTGCCGAGGTA
CTGGTATGGGGTGGTGCAATCGTTCTGTTACTGGCCGCCACGTTTGTCAACCTCCTCGCCGAAATCACTA
TTTTGTTAATGACCACCACCGCCCCGATATTTATTTTCTGCCTGTTGTATGGCTTTATTAAGCCCATGTT
TGATAACTGGCTAAAAACGATTTTCACCGCAATATTAACGATTATGTTTTCCGCCCTGTCTATTCGAATC
GCCATCAATTATCTGAATAAAATCCTTGATGCGGCCACCCAAATGTCCAATATCAGCAATATGGTGACGC
TGGCGGCGCAATGTCTGCTGGCCGGGATTGCAGCGGGTGTCGTGGTGTATTTTTCCGCAAAGATCGCCAA
TGCACTCAGCGGTGTCGCCGTGCAGGCCGTATTACAGGGCGCAGCCATGAGTGGCCTGAGCGGGCTGGCG
AGCAAGTCCGCCGACGCGGCCAGACCGGGCATGAAGGCCGGAGCCATCGGAGCCCGGATGACGACCAAAG
GGGGTGTGGTGGTCGCCACCGCAGCGGGCAGACTCATCGCCGCCGGAACCGGCAAGGCTGTAACAGCATG
GCAAAAGCGCGCCGCCGCTATCGAAAGCATGAAACGCTCCAATCAGCAGCGTAACCGCTAA
 Primer design