SecReT4
Protein ID: 50120553
T4SS name [ID]VirB [411]
Gene symbolvirB5
Locus tagECA1619
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1873390..1874118 [-]
Productconjugal transfer protein
Component typeVirB5
UniProt IDQ6D6R1
KEGG IDeca:ECA1619
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.2e-40, Aligned region: 22..225
Protein Sequence: 242 a.a.     [Download]
>gi|50120553|ref|YP_049720.1| virB5 gene product [Pectobacterium atrosepticum SCRI1043]
MRTRYIMLALSLFISTQAISAGIPVFDAVQNVESINQWVQKLQQWEDTVTHYKSELNAYKQQLATATGVR
NIQGFLSDARSLKTDIDNLRKNGISLDDLLTNHNGSYSSELQHLYSKYKSFSVCSTEQEGIKSQTLTDSC
QQMVLNQAMAIENTAEVENKITGTLSDISALSDRISNAQDSKESQDLANAIAAKSVQLNALTSQWEMSVK
QAEQRTTLLEQQRQKAFEQQQLTAPVADLNNI
 
Nucleotide Sequence: 729 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1874118-1873390 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCGGACCCGCTATATCATGCTGGCATTATCGCTGTTTATTTCCACCCAGGCGATAAGCGCCGGAATAC
CGGTATTCGACGCCGTGCAAAATGTCGAATCTATCAATCAGTGGGTACAAAAACTCCAGCAATGGGAAGA
TACCGTCACCCATTATAAAAGTGAGCTTAACGCCTATAAACAGCAATTAGCCACCGCGACGGGCGTGCGG
AATATCCAGGGGTTTCTCAGCGATGCCCGAAGCCTTAAAACTGATATTGATAATCTCCGCAAAAACGGCA
TTTCACTGGATGACCTGTTAACCAACCATAACGGCTCGTACTCTTCAGAACTTCAACATCTTTACAGTAA
ATACAAATCCTTCAGCGTGTGCAGCACGGAACAGGAGGGAATAAAATCGCAAACGCTAACAGACAGCTGC
CAACAAATGGTCCTGAATCAGGCAATGGCGATAGAAAATACCGCTGAGGTTGAAAACAAGATCACTGGCA
CACTCAGCGATATATCAGCTTTGTCCGACCGTATTTCTAACGCGCAGGACTCGAAAGAGTCACAGGACCT
GGCTAACGCCATCGCGGCAAAAAGCGTACAGTTAAATGCGCTGACCAGCCAGTGGGAAATGTCTGTCAAA
CAGGCAGAACAGCGAACCACGTTGCTGGAACAGCAAAGACAGAAAGCCTTTGAGCAGCAGCAGTTAACGG
CGCCTGTTGCTGACCTTAATAATATATAA
 Primer design