SecReT4
Protein ID: 50120554
T4SS name [ID]VirB [411]
Gene symbolvirB4
Locus tagECA1620
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1874142..1876889 [-]
Productconjugal transfer protein
Component typeVirB4
UniProt IDQ6D6R0
KEGG IDeca:ECA1620
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.5e-44, Aligned region: 271..472
AAA_10 [PF12846], Evalue: 9.6e-33, Aligned region: 535..834
VirB3 [PF05101], Evalue: 6e-11, Aligned region: 3..83
Protein Sequence: 915 a.a.     [Download]
>gi|50120554|ref|YP_049721.1| virB4 gene product [Pectobacterium atrosepticum SCRI1043]
MATLNKALTRPAAIAGIPIVPFVIVSGAIVLLSVYLSYYLVLLLIPAWLEMKAKARTDIHYFGLLWLAFK
TRGRFATNKYFGANAMLANRYDAVDVSEFIEKMKLNERVTLDKHIPYSSHVHPQVIRNRHGDLVSTWELG
GTVFECEDEHHLTLMATHLNNVIRSYEGLPITFYLHRIREKYQDAFAASSGIPFSDDVTALYYQPIKEKP
LWRHRLFFTLCYAPFSRLEKKAMKAQPSGKRTAALDGALKVMLEHRAALASALSRYTATPLGVYEENGRV
YSSQLSFYHRLLTGQWQKVAVTRSPFYDILSTPDVFFTTDTAECQTVSGSRFFRSLEIKDYSPDTATGLL
DALLYAESEYVMTQSFTCMARDEAQNHIRLAEKRLNSAADDAISQREELIVLRDLLQSGHVSCGKYHFSL
LVSSDSADQVVKDVNALAQPFADLGIMTTLSTLSLPAAYLAQLPGVYTLRPRLVAVSSQNFADMASLHNF
HPHKRNGNPWGEAITIMTSPGGGGYYLNLHDSQAGRDDFNEKTPGNTAIIGKTGSGKTMLMTVMQQLMQK
YRNPATFSESAPHKRLSTVYFDKDRAAEMAIRQMGGRYFRLRTGVPTGFNPFALAPTKRNISFIKRLVRM
LCRRNSKPLDPRDEERISTAVDTIMLDYPPEYRRYGITRLLEVLPEPPTKEARTNGLRIRLKQWAQGGEF
GWVFDNETDTFDISDIDNVGIDGTEFLDDDDIRGPITFYLLYRVTGLLDGRRLVMFMDEFWKWLADVEFS
RFSLNMLKVIRKLNGIFIPATQSPDEIVRHPIAPAIIEQCGTQIFLANPKASRADYVEKMKVPDSVYDIV
RHLDPGERYMVVLKTPLRAGETRPFVSMAKMDLSGLGKITRMLSGSEDNLKLFDALYQEGMQPDDWKDAF
LEIAL
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1876889-1874142 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCTACGCTGAACAAAGCACTGACGCGGCCTGCCGCCATAGCCGGTATTCCCATTGTGCCGTTCGTGA
TAGTCAGCGGGGCCATCGTCCTGCTGTCTGTCTATCTCAGCTATTACCTGGTGTTACTGCTCATTCCGGC
CTGGCTGGAGATGAAGGCAAAGGCCAGAACGGATATCCATTATTTCGGGCTGCTCTGGCTGGCCTTTAAG
ACCCGAGGCCGGTTTGCCACCAACAAATATTTCGGCGCCAATGCCATGCTGGCAAACCGCTATGACGCCG
TCGATGTGTCGGAGTTTATTGAGAAGATGAAATTAAACGAGCGCGTTACGCTGGATAAACACATTCCGTA
CTCCTCCCATGTTCACCCCCAGGTAATAAGAAACCGCCACGGCGACTTGGTTTCTACCTGGGAGTTGGGC
GGTACGGTATTTGAATGCGAGGATGAACATCACCTGACGTTAATGGCAACCCATCTTAATAACGTGATCC
GTTCGTATGAGGGCTTGCCGATAACCTTTTATCTTCACCGCATTAGGGAAAAATACCAGGATGCCTTCGC
TGCAAGTTCAGGCATTCCCTTTTCGGACGACGTCACCGCGCTTTATTATCAACCGATAAAGGAAAAACCG
CTCTGGCGGCACCGGCTGTTTTTCACCCTGTGCTATGCGCCGTTCTCCCGACTTGAGAAAAAGGCCATGA
AGGCGCAGCCGTCCGGTAAACGTACAGCGGCGCTGGATGGTGCCCTAAAAGTAATGCTGGAACACCGGGC
GGCGCTGGCTTCTGCCCTGTCCCGCTATACGGCGACGCCGCTGGGGGTGTATGAAGAAAACGGGCGGGTT
TACTCGTCCCAGCTTTCCTTTTATCACCGCCTGCTCACCGGGCAGTGGCAAAAGGTGGCGGTCACGCGCT
CGCCGTTTTACGACATACTCAGCACGCCGGATGTGTTTTTCACCACCGATACCGCCGAGTGCCAGACGGT
CAGCGGCTCCCGCTTCTTTCGTAGTCTGGAAATCAAGGACTACTCACCTGACACCGCGACCGGCCTGCTG
GATGCACTGCTGTACGCGGAAAGCGAGTACGTGATGACACAGTCGTTCACCTGCATGGCGCGGGATGAAG
CACAAAACCATATCCGGCTCGCGGAAAAGCGGCTGAATTCGGCGGCCGACGACGCGATCTCACAACGTGA
AGAACTGATTGTATTGCGCGACCTGCTCCAGTCCGGGCATGTTTCCTGCGGAAAATACCACTTTTCCCTG
CTGGTATCCTCAGACAGCGCCGACCAGGTGGTGAAGGACGTCAACGCGCTGGCGCAGCCCTTCGCCGACC
TCGGCATTATGACCACCCTGTCCACACTGTCGCTGCCCGCTGCGTACCTGGCGCAGTTGCCGGGTGTGTA
TACGCTGCGCCCCCGGCTGGTGGCCGTCAGCAGCCAGAACTTTGCCGATATGGCGAGCCTGCATAACTTT
CACCCCCACAAGCGCAACGGCAATCCGTGGGGCGAGGCCATTACCATCATGACCTCCCCCGGCGGCGGCG
GGTATTACCTGAATTTGCACGACAGCCAGGCAGGACGGGACGACTTCAACGAAAAAACACCCGGGAACAC
GGCGATTATCGGGAAAACCGGCTCCGGGAAAACGATGCTGATGACCGTGATGCAGCAACTAATGCAGAAG
TACCGCAATCCGGCGACGTTTTCCGAATCGGCCCCTCACAAGCGGTTAAGCACCGTCTATTTCGACAAGG
ACCGGGCGGCGGAGATGGCGATACGCCAAATGGGCGGTCGCTACTTCCGACTCCGTACTGGCGTCCCTAC
CGGGTTTAATCCATTTGCGCTTGCGCCGACCAAACGGAACATCAGCTTTATCAAGCGGCTGGTGCGGATG
CTGTGTCGTCGCAATAGCAAACCACTCGATCCTCGCGATGAGGAGCGTATCAGTACCGCCGTGGACACCA
TTATGCTGGACTACCCGCCGGAGTATCGCCGTTACGGCATCACGCGCCTGCTGGAAGTCCTGCCGGAGCC
GCCGACGAAGGAGGCCCGTACAAACGGGCTGCGCATTCGACTGAAACAGTGGGCGCAGGGCGGTGAGTTC
GGCTGGGTATTCGACAACGAAACGGACACCTTCGATATCAGCGACATCGATAATGTGGGCATCGACGGCA
CGGAGTTTCTGGATGATGACGATATTCGCGGTCCCATCACCTTCTATCTGCTGTACCGCGTTACCGGCCT
GCTGGACGGTCGCCGGCTGGTGATGTTCATGGACGAGTTCTGGAAGTGGCTGGCCGACGTGGAATTCTCC
CGCTTTTCGCTCAATATGCTGAAAGTCATTCGCAAGCTGAACGGCATCTTTATCCCCGCCACCCAGTCGC
CTGATGAAATCGTCAGGCATCCCATTGCTCCGGCGATTATTGAACAGTGCGGCACACAGATTTTTCTCGC
CAACCCGAAGGCCAGCCGTGCCGATTACGTGGAAAAGATGAAGGTGCCGGACAGTGTATATGACATCGTC
AGACACCTTGACCCGGGCGAGCGTTATATGGTGGTCCTGAAAACGCCCCTGCGGGCCGGTGAAACCCGGC
CTTTTGTGTCGATGGCGAAAATGGATCTGTCCGGCCTCGGGAAAATCACCCGGATGCTGAGCGGGAGTGA
AGACAACCTGAAACTGTTTGACGCCCTTTATCAGGAAGGGATGCAACCCGATGACTGGAAAGACGCCTTT
CTTGAGATAGCCCTGTAA
 Primer design