SecReT4
Protein ID: 50120555
T4SS name [ID]VirB [411]
Gene symbolvirB2
Locus tagECA1621
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1876901..1877179 [-]
Productconjugal transfer protein
Component typeVirB2
UniProt IDQ6D6Q9
KEGG IDeca:ECA1621
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-15, Aligned region: 4..88
Protein Sequence: 92 a.a.     [Download]
>gi|50120555|ref|YP_049722.1| virB2 gene product [Pectobacterium atrosepticum SCRI1043]
MMRKVKCWPAAVSLLISSRVLAADSGFNKANDTLSNTSTGLLGLAAVTITLATMWVGYKVLFDGKSLQDM
RNVIIGAILIVGASGFGAYWAS
 
Nucleotide Sequence: 279 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1877179-1876901 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGATGCGAAAAGTTAAATGCTGGCCTGCGGCAGTTTCCTTACTGATTTCCTCCCGTGTATTGGCGGCGG
ACAGCGGCTTTAATAAAGCCAATGACACGCTGAGCAATACTTCCACCGGCCTGCTGGGACTGGCCGCCGT
TACCATTACGTTAGCCACCATGTGGGTGGGATACAAAGTGCTGTTTGACGGCAAGAGCCTGCAAGACATG
CGCAACGTTATCATCGGTGCAATCCTTATCGTCGGCGCGTCAGGCTTCGGTGCCTACTGGGCGTCATAA
 Primer design