SecReT4
Protein ID: 50120556
T4SS name [ID]VirB [411]
Gene symbolvirB1
Locus tagECA1622
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]1877179..1877826 [-]
Productconjugal transfer protein
Component typeVirB1
UniProt IDQ6D6Q8
KEGG IDeca:ECA1622
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.5e-19, Aligned region: 9..137
Protein Sequence: 215 a.a.     [Download]
>gi|50120556|ref|YP_049723.1| virB1 gene product [Pectobacterium atrosepticum SCRI1043]
MLSTSAFLAAAMQCAASVHPATALDIARVESDLNPYAIAEILPESKGVISHHPATLAGAISVTRRLEANG
RRYSVGLMQITSTNFRHYGVTARDLFNSCINLSVFERILTDCYRRGGSLKRALSCYYSGNFDTGQQSEPA
FNQTSYVQRIGYVVPSTREDKQSYSPGQTKPEIHYPATVLRGDIPVNAASTPLPLRYPNAVIRGALPVSV
TQEEK
 
Nucleotide Sequence: 648 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c1877826-1877179 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCTTTCCACCTCCGCATTTCTGGCGGCGGCCATGCAGTGTGCCGCCAGCGTTCACCCGGCCACCGCGC
TCGATATCGCGCGGGTCGAATCCGATTTAAATCCCTATGCCATCGCTGAAATCCTGCCGGAGAGTAAAGG
CGTTATTTCACATCACCCCGCCACCCTGGCAGGGGCCATCAGTGTCACCCGGCGGCTTGAGGCCAATGGC
CGACGCTATTCGGTCGGGCTGATGCAAATCACCAGCACCAATTTCCGTCACTACGGTGTGACCGCCCGTG
ACCTGTTTAACTCCTGCATCAATCTGTCGGTCTTTGAGCGCATCCTCACCGACTGCTACCGGCGCGGAGG
CTCCCTGAAACGCGCGCTCAGTTGCTACTACTCCGGCAACTTTGACACCGGTCAGCAGTCGGAACCGGCC
TTCAACCAGACCAGTTACGTCCAGCGTATCGGCTACGTCGTACCCTCAACACGAGAAGATAAACAATCCT
ATTCCCCCGGACAGACAAAACCGGAAATCCATTACCCCGCCACCGTCCTGCGCGGTGACATCCCCGTCAA
CGCTGCATCCACACCACTCCCCCTGCGCTACCCCAACGCTGTGATCCGTGGCGCATTACCTGTCTCTGTC
ACTCAAGAGGAAAAATAA
 Primer design