SecReT4
Protein ID: 51209470
T4SS name [ID]VirB [422]
Gene symbol-
Locus tagpCC31p38
StrainCampylobacter coli plasmid pCC31 (NC_006134)
Repliconplasmid pCC31 [GenBank: NC_006134] [Browse all T4SS(s) in this replicon]
Location [Strand]32100..32759 [+]
ProductcmgB8
Component typeVirB8
UniProt IDQ69BE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.4e-61, Aligned region: 8..217
Protein Sequence: 219 a.a.     [Download]
>gi|51209470|ref|YP_063433.1| cmgB8 [Campylobacter coli]
MKNDFNSAMDYEASFRYLIDKSNKRAWLIAFVSIFIAIISIVAVVLLTPLKTIEPYVIRVDNTTGMVDIL
TMLDEKEISSNEALDKYFISQYVKAREGYYYELLNQDYLLTQLMSSEKVANEYRAWYEGENARDQILKNS
NEVNVQILSIVLGNSNGVKTSTIRAKIITKNLNTRGLSESTKVITLSYDYILAKASEENRILNPLGFKVT
NYRIDEEIR
 
Nucleotide Sequence: 660 bp     [Download]
>gi|51209432|ref|NC_006134.1|:32100-32759 Campylobacter coli plasmid pCC31, complete sequence
ATGAAAAATGACTTTAATTCCGCGATGGATTATGAAGCTAGTTTCAGATATTTAATTGACAAAAGTAATA
AAAGAGCTTGGCTTATTGCTTTTGTTTCTATTTTTATAGCCATAATTTCAATCGTAGCAGTTGTCTTACT
TACTCCTCTAAAAACAATAGAACCTTATGTAATAAGAGTAGACAATACTACAGGAATGGTTGATATTTTA
ACCATGCTTGATGAAAAAGAAATTTCAAGCAATGAAGCTCTTGATAAGTATTTTATCTCTCAATATGTAA
AAGCTAGAGAAGGATATTACTATGAGCTTTTAAACCAAGATTATTTACTTACTCAATTAATGAGCTCTGA
AAAAGTCGCAAATGAATATAGAGCTTGGTACGAAGGTGAAAACGCTAGAGATCAAATTTTAAAAAACTCC
AATGAAGTAAATGTGCAAATTTTAAGTATTGTTCTTGGCAATAGCAATGGGGTTAAAACTTCAACTATAA
GAGCAAAAATTATTACAAAAAATTTAAACACTAGAGGGTTGTCAGAATCCACCAAAGTGATCACATTAAG
CTATGACTATATTTTAGCTAAAGCTAGTGAGGAGAATAGAATTCTAAACCCTCTTGGCTTTAAAGTAACT
AATTACAGAATTGATGAGGAGATAAGATGA
 Primer design