SecReT4
Protein ID: 51209473
T4SS name [ID]VirB [422]
Gene symbol-
Locus tagpCC31p41
StrainCampylobacter coli plasmid pCC31 (NC_006134)
Repliconplasmid pCC31 [GenBank: NC_006134] [Browse all T4SS(s) in this replicon]
Location [Strand]34815..35822 [+]
ProductcmgB11
Component typeVirB11
UniProt IDQ69BE5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.9e-61, Aligned region: 14..312
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-05, Aligned region: 154..181
Protein Sequence: 335 a.a.     [Download]
>gi|51209473|ref|YP_063436.1| cmgB11 [Campylobacter coli]
MSITLDKYTQKYFGEFLKDDNINEICYNGDNKIWVQNSKGLWESVQTELDFESAGHFATASASFKKDKID
VSRPILSCILVGGERMQIVIPPATKSEHISITIRKPSKTRFKMEDHVKSGLFEDLSPDDKNIIKPSDEEL
IKLYKERDYQAFISKAVSYGKNIIIAGETGSGKTTFMKTLIDFISLDDRIITIEDVEEIKFYEHKNFVQL
FYPSEAKSTDFLNSATLLKSCLRMKPDRILLAELRGAETYDFINVLASGHGGSITSCHAGSPEETFTRLA
LMTLQNPQGQCVPFEIIQKTLKDLIDIVVHIHAHHGKRRISGIYFKEIENIKLER
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|51209432|ref|NC_006134.1|:34815-35822 Campylobacter coli plasmid pCC31, complete sequence
ATGTCAATAACGCTAGATAAATACACTCAAAAATATTTCGGAGAATTTTTAAAAGATGATAATATCAATG
AAATCTGCTATAACGGCGATAATAAAATTTGGGTACAAAACTCCAAAGGATTATGGGAATCTGTACAAAC
AGAACTTGATTTTGAGTCCGCAGGACATTTTGCAACTGCTTCAGCCTCTTTTAAAAAAGACAAAATAGAT
GTATCACGCCCTATTCTTTCTTGTATTTTGGTAGGCGGAGAGCGTATGCAAATTGTTATTCCGCCTGCTA
CCAAAAGCGAACATATTTCAATTACTATCAGAAAACCAAGCAAAACTCGCTTTAAAATGGAAGATCATGT
TAAAAGTGGACTTTTCGAAGATTTAAGCCCTGATGATAAAAATATAATCAAACCAAGCGATGAAGAATTA
ATCAAGTTATATAAAGAAAGAGATTATCAAGCTTTTATATCAAAAGCTGTTAGCTATGGTAAAAATATCA
TCATCGCTGGTGAAACTGGCAGTGGTAAAACCACTTTTATGAAAACTCTTATTGATTTCATAAGCCTCGA
TGATCGGATCATAACAATAGAAGATGTTGAAGAGATCAAATTCTACGAACACAAAAATTTCGTGCAATTA
TTCTATCCAAGTGAAGCAAAAAGCACAGATTTTTTAAATTCTGCAACGCTTTTAAAATCTTGTCTAAGAA
TGAAGCCTGACAGAATTTTACTTGCAGAGCTTAGAGGTGCGGAAACTTATGATTTTATCAATGTCTTAGC
TAGTGGACATGGTGGAAGCATTACAAGTTGTCATGCAGGAAGTCCTGAAGAAACATTTACACGACTTGCC
TTAATGACTTTGCAAAACCCACAAGGTCAATGCGTTCCTTTTGAAATTATCCAAAAAACACTTAAAGATT
TAATTGATATTGTCGTGCATATCCACGCTCATCACGGAAAAAGGCGTATTAGTGGCATTTATTTTAAAGA
AATAGAGAATATCAAATTGGAGAGATAA
 Primer design