SecReT4
Protein ID: 51209474
T4SS name [ID]VirB [422]
Gene symbol-
Locus tagpCC31p42
StrainCampylobacter coli plasmid pCC31 (NC_006134)
Repliconplasmid pCC31 [GenBank: NC_006134] [Browse all T4SS(s) in this replicon]
Location [Strand]35823..37634 [+]
ProductcmgD4
Component typeVirD4
UniProt IDQ69BE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-105, Aligned region: 94..563
TraG-D_C [PF12696], Evalue: 6.4e-26, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 1.2e-18, Aligned region: 344..542
Protein Sequence: 603 a.a.     [Download]
>gi|51209474|ref|YP_063437.1| cmgD4 [Campylobacter coli]
MQNNKSIQIIFLAISSVFLTYLLTPIVFFFLNKVKIMKAIEIYNINFTIQAIVNDYPKIWLSLSITFGIC
LIIFSVLVLSLKAKKSQFGEARFANFNEIKKMNLFGDKGIIIGKYKGKLLRFGGQQFVALGAPTRSGKGV
GIVIPNLLEWQESAVVQDIKQECFDYTSKYRKEILKQEVYLFNPFSRQTHRYNPLTYIDMSDKEHCDSQL
MDLANILYPLDGDSTSKFFNGLAQNLFIGLCYLWRDLQLTDMGKEFQKSFNVDVGNFNFYNILQLSKGFS
LKNEEKTLRGFDDTYNFLVYCEILDEATIRRLETYFNINSDATKSGIMSSFNAPLVPFESETLRLSTETS
DFDLRDLRKKKMTIYIGITPDQLANAQFILNIFWSQLILLNTKELPQSNKDLKYTCLMVMDEFTAPGRIP
IYQSAISFMAGYWLRSLMIYQSNSQLETQPPLGYGKEGAKTLLTNHACQIFYAPREQEDAEAISRILGNT
TFKTKSRSINTGNNGGGSHSISEASRALMLPQELREMPFENELITIDSGKPILCNKAFYYSDSYFMDKFK
AVSKSLSGIKKIPSRKQLEDAILKGECKIKIQIIGENNEKNVA
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|51209432|ref|NC_006134.1|:35823-37634 Campylobacter coli plasmid pCC31, complete sequence
ATGCAAAATAACAAAAGTATTCAAATTATTTTTCTTGCGATTTCTAGTGTTTTTCTTACATATTTACTAA
CACCTATTGTATTTTTCTTTTTAAATAAAGTAAAAATAATGAAAGCAATTGAAATATACAACATAAATTT
CACCATTCAAGCCATAGTTAATGACTATCCAAAAATATGGCTTTCTTTGAGTATTACTTTTGGAATTTGT
CTTATTATTTTTTCTGTTTTGGTGTTATCTTTAAAAGCCAAAAAATCTCAATTTGGTGAAGCTAGATTTG
CAAATTTTAATGAGATTAAAAAAATGAATTTATTTGGCGATAAAGGAATTATTATCGGAAAATATAAAGG
AAAATTGCTAAGATTTGGCGGTCAGCAATTTGTAGCTTTAGGAGCTCCCACAAGAAGTGGTAAGGGTGTA
GGTATAGTAATACCAAACTTATTAGAGTGGCAAGAAAGTGCTGTTGTGCAAGATATTAAGCAAGAATGTT
TTGACTACACAAGCAAATATAGAAAAGAGATTTTAAAACAAGAAGTTTATTTGTTTAATCCATTTTCAAG
ACAGACTCATCGTTATAATCCCTTGACTTACATTGATATGAGTGATAAAGAACATTGCGATAGTCAATTA
ATGGATTTGGCTAACATACTTTATCCACTTGATGGGGATTCTACTTCAAAATTTTTTAATGGTTTAGCAC
AAAATCTCTTTATAGGTCTTTGTTATTTATGGCGTGATTTGCAACTCACAGATATGGGTAAAGAATTTCA
AAAATCTTTTAATGTAGATGTAGGAAATTTTAACTTTTACAATATTTTGCAACTCTCAAAAGGCTTTTCA
CTCAAGAATGAAGAAAAAACCTTAAGAGGTTTTGATGATACATATAATTTCTTGGTCTATTGTGAAATCT
TAGATGAAGCAACTATAAGGCGTTTAGAAACTTATTTTAATATCAACTCAGATGCTACTAAATCAGGCAT
AATGAGCTCTTTTAATGCTCCGCTTGTGCCATTTGAAAGCGAAACATTAAGATTAAGCACAGAAACAAGT
GATTTTGATTTGCGAGATTTGCGTAAAAAGAAAATGACAATTTATATAGGAATTACGCCTGATCAATTAG
CAAATGCACAATTTATTTTAAATATTTTTTGGTCGCAACTTATTTTATTAAACACCAAAGAATTGCCACA
AAGCAATAAAGATTTAAAATATACTTGTTTAATGGTTATGGATGAATTTACTGCACCTGGTAGAATTCCT
ATCTATCAATCAGCAATCAGTTTTATGGCTGGTTATTGGTTAAGATCTTTGATGATTTATCAATCAAATT
CACAACTTGAAACACAACCACCTTTGGGCTATGGAAAAGAAGGAGCTAAAACACTCTTAACAAATCATGC
TTGTCAGATTTTCTATGCACCAAGAGAGCAAGAAGACGCAGAAGCTATCTCTAGGATTTTAGGAAATACT
ACTTTTAAAACAAAATCAAGAAGTATTAATACAGGCAATAATGGAGGTGGATCACATAGTATTAGCGAAG
CAAGTAGGGCTTTAATGTTACCACAAGAACTTAGAGAAATGCCTTTTGAAAATGAACTAATTACTATTGA
TAGTGGAAAACCTATTTTATGCAATAAAGCATTTTATTATTCAGATTCATATTTCATGGATAAATTTAAA
GCTGTTTCAAAAAGCCTATCAGGAATAAAAAAAATCCCTTCACGCAAACAATTAGAAGATGCAATCTTGA
AAGGAGAATGCAAAATTAAAATTCAAATTATAGGAGAAAACAATGAAAAAAATGTCGCTTAG
 Primer design