SecReT4
Protein ID: 51209550
T4SS name [ID]VirB [423]
Gene symbol-
Locus tagpTet_p37
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pTet (NC_006135)
Repliconplasmid pTet [GenBank: NC_006135] [Browse all T4SS(s) in this replicon]
Location [Strand]32290..32457 [+]
ProductcmgB7
Component typeVirB7
UniProt IDQ69B99, A1WZX5
KEGG IDcjj:CJJ81176_pTet0035
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|51209550|ref|YP_063482.1| cmgB7 [Campylobacter jejuni subsp. jejuni 81-176]
MQAKLIFILLLGVLFFSACSTKNQGKYDEFFNNQTGWIPVNTQNKDLNKGTMDEK
 
Nucleotide Sequence: 168 bp     [Download]
>gi|51209513|ref|NC_006135.1|:32290-32457 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGCAGGCTAAATTAATTTTTATTTTATTACTTGGTGTTTTATTTTTTAGTGCTTGTAGCACTAAAAATC
AGGGTAAATATGATGAATTTTTTAACAATCAAACAGGATGGATTCCTGTTAATACTCAAAACAAAGATTT
AAATAAAGGAACTATGGATGAAAAATGA
 Primer design