SecReT4
Protein ID: 51209551
T4SS name [ID]VirB [423]
Gene symbol-
Locus tagpTet_p38
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pTet (NC_006135)
Repliconplasmid pTet [GenBank: NC_006135] [Browse all T4SS(s) in this replicon]
Location [Strand]32447..33109 [+]
ProductcmgB8
Component typeVirB8
UniProt IDA1WZX6, Q847A8
KEGG IDcjj:CJJ81176_pTet0036
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-60, Aligned region: 9..217
Protein Sequence: 220 a.a.     [Download]
>gi|51209551|ref|YP_063483.1| cmgB8 [Campylobacter jejuni subsp. jejuni 81-176]
MKNEFNTAIDYEASFRYLIEKSNKRAWLIAFISIFIAIISIIAVVLLTPLKTIEPYVIRVDNTTGMVDIL
TMLDEKEIKANEALDKYFISTYVKAREGYYYDLLNQDYLLTQLMSSEKVANEYRALYEGDNARDQILKNS
NEVSVQILSIVLGESNGVKTATVRAIITTKNLTSKGTTQATKVITLSYDYILAKASEENRFLNPLGFKVL
TYRIDDEVAQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|51209513|ref|NC_006135.1|:32447-33109 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGAAAAATGAGTTTAATACTGCAATAGATTATGAAGCAAGTTTTAGATACTTAATTGAAAAAAGTAATA
AAAGAGCTTGGCTTATTGCTTTTATTTCTATTTTTATAGCCATTATTTCCATTATAGCTGTTGTTTTACT
TACTCCTTTAAAAACAATAGAACCGTATGTAATAAGAGTAGACAATACTACAGGAATGGTTGATATTTTA
ACCATGCTTGATGAAAAAGAAATTAAAGCAAATGAAGCATTAGATAAATATTTTATTAGCACTTATGTAA
AAGCTAGAGAAGGCTATTATTATGATCTTTTAAATCAAGATTATTTACTTACTCAATTAATGAGTTCTGA
AAAAGTAGCAAATGAATATAGGGCTTTATATGAAGGTGATAATGCAAGAGATCAAATTCTAAAAAACTCC
AATGAAGTAAGTGTTCAAATTTTAAGTATTGTTTTAGGAGAAAGTAACGGAGTGAAAACTGCTACAGTCA
GGGCAATTATTACTACAAAAAATTTAACTTCCAAAGGAACAACTCAAGCAACAAAAGTAATAACATTAAG
TTATGACTATATCTTAGCAAAAGCTAGCGAAGAAAACAGATTTTTAAATCCTTTAGGTTTTAAAGTATTA
ACTTATAGAATTGATGACGAGGTGGCACAATGA
 Primer design