SecReT4
Protein ID: 51209554
T4SS name [ID]VirB [423]
Gene symbol-
Locus tagpTet_p41
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pTet (NC_006135)
Repliconplasmid pTet [GenBank: NC_006135] [Browse all T4SS(s) in this replicon]
Location [Strand]35122..36168 [+]
ProductcmgB11
Component typeVirB11
UniProt IDQ69B95
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.3e-61, Aligned region: 31..330
FtsK_SpoIIIE [PF01580], Evalue: 2.3e-05, Aligned region: 175..199
Protein Sequence: 348 a.a.     [Download]
>gi|51209554|ref|YP_063486.1| cmgB11 [Campylobacter jejuni subsp. jejuni 81-176]
MLIVILIFQKFINLQGKRMSITLDKYTQKFFGEFLKDDNINEICYNGDNKIWVQNSKGLWECIDTKLDFE
QAGHFATASASFKKDKIDVSRPILSCILVGGERMQIVIPPATKSEHISITIRKPSKTRFKMEDHIKSGLF
EDLNPDDKNKIKPSDEELIKLYEARDYQNFISKAVSYGKNIIIAGETGSGKTTFMKTLIDFISLDDRIIT
IEDVEEIKFYEHKNFVQLFYPSEAKSTDFLNSATLLKSCLRMKPDRILLAELRGAETYDFINVLASGHGG
SITSCHAGSPEETFTRLALMTLQNPQGQCVPFEIIQKTLKDLIDIVVHIHAHHGKRRISGIYFKEMER
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|51209513|ref|NC_006135.1|:35122-36168 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGTTAATCGTGATATTGATTTTTCAAAAGTTTATAAACTTACAAGGAAAAAGAATGTCAATAACGCTAG
ATAAATATACTCAAAAATTTTTTGGAGAATTTTTAAAAGATGATAATATCAATGAAATCTGCTATAACGG
CGATAATAAAATTTGGGTACAAAACTCTAAAGGATTATGGGAATGTATAGATACTAAACTTGATTTTGAA
CAAGCTGGACATTTTGCAACTGCTTCAGCCTCATTCAAAAAAGATAAAATAGATGTATCACGCCCTATTC
TTAGTTGTATTCTAGTAGGTGGAGAGCGTATGCAAATTGTTATTCCTCCTGCTACAAAAAGCGAACACAT
TTCAATTACTATTAGAAAGCCAAGCAAAACTCGCTTTAAAATGGAAGATCATATTAAAAGCGGACTTTTT
GAAGATTTAAATCCTGATGATAAGAATAAAATCAAACCAAGCGATGAAGAATTAATCAAGCTATATGAAG
CAAGAGATTATCAAAATTTTATATCCAAAGCTGTTAGCTATGGTAAAAATATTATTATCGCTGGTGAAAC
AGGAAGCGGTAAAACTACCTTTATGAAAACTCTTATTGATTTTATAAGCCTTGATGATAGGATTATCACA
ATAGAAGATGTTGAAGAAATCAAATTCTATGAACACAAAAATTTCGTGCAATTATTCTATCCTAGCGAAG
CAAAAAGTACAGATTTTTTAAATTCTGCAACACTTTTAAAATCTTGTTTAAGAATGAAGCCTGATAGGAT
TTTACTAGCAGAGCTTAGAGGTGCTGAAACTTATGATTTTATTAATGTTTTAGCTAGTGGTCATGGTGGA
AGTATCACAAGTTGCCATGCAGGAAGCCCCGAAGAAACATTTACACGACTTGCTTTAATGACTCTACAAA
ATCCACAAGGTCAATGCGTGCCTTTTGAAATTATCCAAAAAACACTTAAAGACTTAATAGATATTGTCGT
GCATATCCATGCCCATCATGGAAAAAGGCGTATTAGCGGCATTTATTTTAAAGAAATGGAGAGATAA
 Primer design