SecReT4
Protein ID: 51246983
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB12
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]12879..13820 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDQ6AIH1
KEGG IDdps:DPPB12
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.4e-80, Aligned region: 16..283
FtsK_SpoIIIE [PF01580], Evalue: 2.6e-05, Aligned region: 133..167
TrwB_AAD_bind [PF10412], Evalue: 3.2e-05, Aligned region: 139..180
Protein Sequence: 313 a.a.     [Download]
>gi|51246983|ref|YP_066866.1| conjugal transfer protein TrbB [Desulfotalea psychrophila LSv54]
MLDSNILNSLRHNMGQTIMAALDDNDVMEIMLNGDSTLWVDTFSRGQYCTGKVDPIKAKGIISMVASLLG
TTVTKDSPIVEGELPLDGSRFEGLFPPVVENPVFTIRKKALKVFTLDDYVDNNIMSEKARDHIHQAVDSK
QNILVVGGTGSGKTTLCNAVLAEISTRCPDDRLIIIEDTAELQCKCKNKVILRTAPTTTMQHLLKATMRL
RPDRIIVGEVRGGEALDLLKAWNTGHPGGLCTVHANDSKGGLIRIEQLIAEVSKSPMQVLIKEAINLVIF
IKKTPQGRKVKEVAKVTNIADGNYNLEYIIKDN
 
Nucleotide Sequence: 942 bp     [Download]
>gi|51246971|ref|NC_006139.1|:12879-13820 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGCTTGATTCCAATATTTTAAATAGCCTACGCCATAATATGGGCCAAACCATTATGGCTGCCCTGGACG
ATAACGATGTGATGGAGATAATGCTCAATGGTGATTCGACTCTATGGGTCGATACATTCAGCAGAGGCCA
ATATTGTACGGGCAAGGTCGATCCCATAAAAGCTAAGGGAATCATCAGCATGGTGGCCTCCCTCCTTGGA
ACCACAGTAACAAAAGACAGCCCAATAGTTGAAGGGGAGCTCCCCCTAGACGGATCTCGCTTTGAAGGTT
TGTTCCCTCCTGTTGTTGAAAACCCTGTTTTCACGATAAGGAAAAAAGCTCTCAAAGTCTTCACCCTAGA
TGATTATGTCGACAACAATATAATGTCAGAAAAAGCCAGAGATCACATACATCAAGCTGTGGATTCAAAA
CAAAATATTTTAGTTGTTGGCGGCACTGGTTCAGGCAAAACAACTTTATGCAACGCTGTACTAGCTGAAA
TATCTACTAGATGCCCTGATGACAGGTTGATCATCATCGAAGACACAGCAGAGTTACAGTGCAAATGTAA
AAATAAAGTCATTTTAAGAACAGCTCCTACGACAACTATGCAACATCTGCTGAAGGCTACCATGCGTCTT
AGGCCAGACAGAATAATTGTTGGAGAAGTCAGAGGTGGCGAAGCTTTGGATTTACTTAAGGCATGGAACA
CAGGCCATCCGGGGGGCCTGTGTACGGTACATGCAAATGATAGCAAAGGAGGATTGATAAGAATTGAACA
ATTAATAGCAGAGGTATCAAAATCACCTATGCAGGTACTCATCAAAGAGGCTATCAACCTGGTTATTTTC
ATCAAGAAAACACCTCAAGGAAGAAAGGTCAAAGAGGTTGCTAAAGTTACCAATATTGCTGACGGAAACT
ATAACCTCGAATACATTATAAAAGATAACTAA
 Primer design