SecReT4
Protein ID: 51246984
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB13
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]13830..14156 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ6AIH0
KEGG IDdps:DPPB13
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-17, Aligned region: 3..95
Protein Sequence: 108 a.a.     [Download]
>gi|51246984|ref|YP_066867.1| conjugal transfer protein TrbC [Desulfotalea psychrophila LSv54]
MFSLNKTTLFTSVSILLLLMACPAFASEIVEFSSPIEKVMGTITGPTGKLISILMMAICGVTYWIRKDDL
EGGFKMLLGVVFAISFIAFAGSIVDNVFSGQFTAGALI
 
Nucleotide Sequence: 327 bp     [Download]
>gi|51246971|ref|NC_006139.1|:13830-14156 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGTTCTCATTAAACAAAACCACTTTATTCACATCAGTTAGCATACTTCTTCTTTTAATGGCTTGCCCAG
CTTTTGCATCAGAAATTGTCGAATTTTCATCACCAATAGAAAAAGTTATGGGTACTATCACGGGCCCCAC
TGGAAAACTAATATCAATCCTTATGATGGCTATATGTGGTGTTACATACTGGATCAGAAAAGATGATTTG
GAAGGTGGTTTCAAGATGCTGCTAGGAGTTGTTTTTGCTATTTCGTTTATCGCTTTCGCAGGTTCAATCG
TAGACAACGTCTTTTCAGGACAGTTTACAGCAGGGGCGCTTATATAA
 Primer design