SecReT4
Protein ID: 51246985
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB14
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]14157..16871 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ6AIG9
KEGG IDdps:DPPB14
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.9e-32, Aligned region: 555..817
CagE_TrbE_VirB [PF03135], Evalue: 3.1e-26, Aligned region: 289..497
VirB3 [PF05101], Evalue: 1.8e-17, Aligned region: 4..85
DUF87 [PF01935], Evalue: 6.8e-06, Aligned region: 555..590
AAA_23 [PF13476], Evalue: 5.9e-05, Aligned region: 555..575
Protein Sequence: 904 a.a.     [Download]
>gi|51246985|ref|YP_066868.1| conjugal transfer protein TrbE [Desulfotalea psychrophila LSv54]
MRCDIPIRQSLHRADLTLGAESDLVFFTALLSFLVAFSGPTKLSVASGIFFWMSMIVLLRFIAKKDPIMS
KIWRKHINQQNFYPAKTCLTDKARAMSYKDHTTVKNKSFANLLQYCACVDDGIILNKDGSFLAGWEYQSI
DTASSTNNELASLTAFFNNGVKTLGDGWTIHVDAVRIKADFYPPRSASHFPDLVTEAIEEERREIFESGI
HYETKHVIFVTYKPNLTTEKLSSFAYKKQLQEKGNKAGRESLKALSFFQNALNEIEDVLSTAVRLTRLLD
YTTEDETGTEHIYSKLLSHIQFSVTGVEQPIKLPTVPMYLDTTIGSQDLVGGLVPKIGENHLAVIGIDGF
PQDSYPMIFNVLDSLSISYRFNSRFICMDQYTAQTTLNKYRATWAQKIINPLDKIFNKANPKVNRDASVM
ASDTEEALHDEQAGFVSHGFYSANIIISNENQEQLEDACREIRRSLQGIGFGCRRETINCLEAWLGSHPG
NSYSNIRQVLINTLNLSHLLPLSSIWTGHTYNPSPFFPVNSPPLLYAATNGSTPFRLNLHVGDLGHTLIF
GPTGSGKSTLLSTLCAQFRRYANSNIFIFDKGMSMYPLVSAAEGTHYNIGADDSTLAFCPLQHVSTPASE
AWACEYIEQLVTMQGVTVKPNHRIAIHDAIQQISSSPENMRSLSNLFHYIQEPELKEALVHYTNNGPMGR
LLDAESDNISMSNFTVFEMEELMNMGEENLIPVLLYLFHLIEKSFKGQPSILVLDEAWIMFSHPVFRKKI
REWLKVLRKANCAVIMATQSLSDAKSSGIMDVLNESCQTKIYLPNITATNETEAAMYYGLGLNTRQIEII
ATARPKREYYIVSPEGRRLINLSLGPVALSFAGASSKEDIKEIKELEKEHGHVWPKAWLKKRNI
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|51246971|ref|NC_006139.1|:14157-16871 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGAGATGTGATATTCCCATCAGGCAGAGTCTCCATCGAGCAGACTTAACACTAGGCGCTGAATCTGACC
TTGTTTTTTTTACAGCTTTGCTTTCTTTTCTGGTCGCTTTTTCTGGCCCGACAAAGCTGTCTGTTGCCAG
TGGCATATTTTTTTGGATGTCGATGATAGTCCTTTTGCGGTTTATCGCTAAAAAAGACCCCATCATGTCT
AAAATCTGGCGCAAGCATATAAATCAACAGAATTTTTACCCTGCAAAAACTTGCTTAACAGATAAGGCTC
GCGCAATGTCATACAAAGACCACACAACAGTTAAAAACAAATCGTTTGCCAATCTTTTGCAATACTGCGC
TTGCGTCGACGATGGCATTATCCTCAACAAGGATGGCTCATTTTTAGCTGGATGGGAATATCAATCAATC
GATACTGCGAGTTCAACAAACAACGAACTCGCCAGCCTAACTGCGTTTTTCAATAATGGCGTTAAAACCC
TCGGTGATGGCTGGACGATACACGTTGACGCAGTGAGAATAAAAGCCGACTTTTACCCTCCAAGGTCAGC
AAGCCACTTCCCCGATCTCGTTACCGAGGCCATCGAGGAGGAGAGACGAGAAATTTTTGAAAGCGGGATA
CACTATGAGACTAAGCACGTTATTTTTGTTACCTACAAACCAAACCTAACAACTGAAAAACTCTCAAGTT
TTGCGTATAAAAAACAACTCCAAGAAAAAGGCAACAAAGCGGGCAGGGAATCTTTAAAGGCCCTCTCCTT
TTTCCAAAACGCTTTGAACGAAATTGAGGATGTTCTATCAACCGCAGTCCGTTTGACACGATTACTTGAT
TACACGACAGAAGACGAAACAGGCACAGAACACATCTATTCAAAACTACTGAGCCACATACAGTTCTCAG
TCACAGGGGTTGAACAACCTATCAAATTACCAACCGTTCCGATGTACCTGGATACGACTATAGGTAGTCA
AGATTTAGTCGGTGGCCTAGTTCCTAAAATTGGTGAGAACCACCTTGCTGTGATCGGAATCGATGGCTTC
CCACAGGATAGCTATCCTATGATTTTTAACGTGTTAGACAGTTTATCTATATCATATCGGTTTAACTCTC
GTTTCATCTGTATGGATCAGTATACCGCTCAAACAACACTCAACAAATATCGTGCAACCTGGGCGCAAAA
GATCATCAATCCTTTGGATAAAATTTTCAACAAGGCCAACCCAAAGGTCAACCGTGACGCTAGTGTCATG
GCGAGTGACACCGAAGAGGCTTTACACGACGAACAAGCAGGTTTTGTTTCTCACGGATTTTATTCTGCAA
ATATCATCATCAGCAACGAGAACCAGGAACAACTTGAAGACGCTTGCAGAGAAATCAGACGATCTTTACA
GGGAATAGGTTTTGGGTGTAGGCGAGAAACAATTAACTGCCTGGAAGCGTGGCTCGGAAGCCATCCTGGC
AACAGTTATTCAAACATTCGCCAAGTTTTAATCAATACCCTTAACTTGTCGCATCTACTGCCATTATCAT
CAATTTGGACAGGTCACACCTACAACCCTAGTCCATTTTTCCCTGTTAATTCGCCCCCCCTGCTATACGC
AGCGACCAATGGTTCAACACCGTTCCGCCTAAATTTACACGTTGGTGATCTCGGTCATACGCTTATTTTT
GGCCCTACTGGTAGCGGCAAATCCACCTTGTTATCAACTCTTTGCGCTCAATTCCGACGATACGCTAATT
CCAATATTTTTATTTTTGACAAAGGGATGTCGATGTATCCATTGGTTAGTGCGGCAGAGGGCACCCACTA
CAATATTGGTGCAGATGATTCCACCCTGGCTTTTTGTCCATTACAACATGTCTCAACACCAGCAAGCGAA
GCCTGGGCCTGTGAGTATATAGAACAGCTCGTCACCATGCAGGGGGTTACAGTAAAGCCAAACCACAGGA
TAGCTATACACGACGCTATACAACAAATTAGTAGCAGCCCTGAAAACATGCGTTCGTTGAGCAATCTTTT
CCATTATATCCAGGAGCCAGAACTAAAAGAGGCTCTTGTACATTATACCAACAATGGCCCTATGGGCCGA
CTCCTGGACGCTGAAAGTGATAATATTTCTATGTCCAATTTCACGGTTTTCGAAATGGAAGAATTAATGA
ATATGGGGGAAGAAAATTTAATTCCCGTATTACTCTATCTCTTTCATTTAATTGAAAAGTCTTTTAAAGG
GCAACCATCAATTTTGGTACTAGATGAAGCATGGATAATGTTTAGTCATCCTGTTTTTAGAAAAAAAATA
AGGGAATGGCTAAAAGTTCTACGGAAGGCAAATTGTGCAGTAATTATGGCAACACAAAGTTTATCAGATG
CCAAATCTTCTGGAATTATGGATGTTTTAAACGAATCTTGTCAGACAAAGATTTATTTACCTAATATCAC
CGCAACCAATGAAACAGAGGCTGCTATGTATTATGGATTAGGACTAAACACTAGACAAATAGAAATAATA
GCAACGGCTCGGCCCAAAAGGGAATACTATATTGTTAGCCCTGAGGGGAGAAGATTGATAAACCTATCAC
TTGGCCCTGTTGCTCTTTCTTTTGCTGGAGCATCTAGCAAAGAAGATATAAAAGAGATAAAAGAATTAGA
GAAAGAGCATGGTCATGTTTGGCCTAAAGCTTGGCTCAAAAAGAGAAATATATAA
 Primer design