SecReT4
Protein ID: 51246986
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB15
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]16825..17688 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ6AIG8
KEGG IDdps:DPPB15
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 287 a.a.     [Download]
>gi|51246986|ref|YP_066869.1| conjugal transfer protein TrbJ [Desulfotalea psychrophila LSv54]
MVMFGLKLGSKREIYNTMKKIYSLLIIVCLITTIIAKQDAKAGIPVTCINCSNMFTQILEYANDIESLME
GIKRYEELATHTTQNYNKISGDIKRYENMLKNTKSLPDNMNTKLAIKLKYLTNDIKSTGVRYADFAALQD
IFSQLYPDYQSVAKSINPNLSSKLTRKYTEDHYDTWAKEAQSVTGKAFSMSGDQLNDLVESGGFEDAVND
LISTPEGQKEALDASNQLAAMQLEEARNLRALLAVSIQAQQQVAQKQQGIEYIQEQQSRNFWETREPTQT
LNLPHGW
 
Nucleotide Sequence: 864 bp     [Download]
>gi|51246971|ref|NC_006139.1|:16825-17688 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGGTCATGTTTGGCCTAAAGCTTGGCTCAAAAAGAGAAATATATAACACCATGAAAAAAATATACTCAT
TATTAATTATAGTTTGTTTAATCACCACCATCATTGCCAAACAAGACGCAAAGGCTGGTATCCCTGTAAC
ATGCATTAATTGCTCAAACATGTTTACCCAAATATTAGAATATGCAAATGACATAGAATCTTTGATGGAA
GGCATAAAACGGTATGAGGAACTAGCCACACATACCACCCAAAATTATAATAAAATTTCGGGCGATATTA
AACGTTATGAAAATATGTTGAAAAACACCAAAAGCTTACCTGACAATATGAATACCAAACTTGCAATAAA
ACTTAAATATCTCACAAATGATATCAAAAGTACTGGTGTTAGATACGCTGACTTTGCGGCTCTCCAGGAT
ATTTTTTCCCAATTATACCCGGATTACCAAAGTGTTGCCAAATCAATTAACCCTAATTTGTCATCTAAAT
TAACAAGGAAGTACACAGAAGACCACTATGACACATGGGCCAAGGAAGCCCAAAGTGTTACAGGCAAAGC
ATTTAGCATGAGCGGTGATCAACTAAATGACTTGGTCGAGAGTGGGGGCTTTGAAGATGCTGTCAATGAC
TTAATCTCAACACCTGAAGGGCAAAAAGAGGCACTAGATGCATCCAACCAACTTGCCGCCATGCAACTGG
AAGAGGCCAGGAATCTAAGGGCCTTACTAGCAGTAAGTATACAAGCACAACAACAGGTTGCCCAAAAGCA
ACAAGGCATTGAATACATCCAGGAACAACAGAGCAGAAATTTTTGGGAGACAAGGGAGCCAACCCAAACC
CTGAACTTACCTCATGGCTGGTAA
 Primer design