SecReT4
Protein ID: 51246987
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB16
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]17813..19246 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ6AIG7
KEGG IDdps:DPPB16
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.5e-27, Aligned region: 140..355
Protein Sequence: 477 a.a.     [Download]
>gi|51246987|ref|YP_066870.1| conjugal transfer protein TrbL [Desulfotalea psychrophila LSv54]
MLLSNRCPLAISSGVSKSLPLATLSFPASSKISLKRANCVSTTLEYAPTRSLTSSSGLQPTTHSKRTENN
AINFKLFFKTFPFLLVLILLTPTCVHATDINNSLINFIQQTVSIFATNAEIVGNRMEILALDIFQLLLLA
EVIWLGLRMALKISDFKDTVIEFVKVLLVASLVLYIIKNHAEWINALSYGLTASYDGSLASSTSQSPETV
VLNAIFIYIEALLNKLHITSPIDATFILLGVLVIAICAAFITVTIVCILIEAYFVLNISVILLGFGALKF
TREFTWNYLKYILSVGLKLLTIKVLANFISSFFASAHNPLAVPAGDIGIQYMIHAIICMVVITGIFKTIP
TTVASFVTNAGIGSNPIGAVVATVAGVAATGKMAGASSKKAGAVAAAAGMVSGGVGTAAMAAGKMAATAT
VGSKMAGAGQAAASLGKGINSAGQAAKTAGSITGSVLKGNAGEVKSKASEIINKMKK
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|51246971|ref|NC_006139.1|:17813-19246 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGTTATTATCTAATCGTTGCCCTTTGGCAATCAGCTCAGGGGTCAGTAAAAGCTTGCCATTAGCCACCC
TAAGCTTCCCCGCCTCTTCGAAAATTTCATTAAAAAGAGCTAATTGTGTATCTACAACTTTAGAATATGC
CCCTACACGATCACTTACCTCTTCTTCTGGTTTACAGCCTACCACACATAGTAAAAGAACAGAGAACAAT
GCTATTAATTTCAAATTATTCTTTAAAACCTTTCCCTTTTTATTAGTTTTAATATTGCTAACACCAACGT
GCGTTCACGCTACTGACATCAACAACAGCCTAATTAATTTTATTCAGCAAACAGTTTCCATCTTCGCTAC
AAATGCAGAGATCGTTGGAAACAGAATGGAGATTTTGGCACTAGATATATTCCAACTTCTCTTACTAGCC
GAGGTAATATGGCTTGGATTAAGAATGGCTTTAAAGATATCTGATTTTAAAGATACTGTTATTGAATTTG
TTAAAGTCTTATTAGTCGCAAGCCTAGTTCTCTATATCATAAAAAACCATGCGGAATGGATCAACGCCCT
ATCTTACGGCTTAACTGCATCCTATGATGGCAGTCTTGCAAGCTCCACGTCACAATCTCCAGAAACAGTC
GTTCTTAATGCTATTTTTATATATATAGAGGCGCTTTTGAATAAGTTACATATCACTAGCCCGATAGACG
CAACTTTCATTTTACTTGGCGTATTGGTTATTGCTATCTGTGCTGCATTTATAACGGTAACAATCGTATG
CATATTAATTGAAGCGTATTTTGTTTTAAATATTTCAGTTATTCTATTGGGCTTTGGTGCATTAAAATTT
ACACGCGAGTTTACCTGGAATTACCTTAAATACATTTTGTCAGTAGGGCTTAAACTGCTGACAATTAAAG
TTTTAGCCAATTTCATAAGCTCATTCTTTGCAAGCGCCCACAACCCTCTCGCTGTGCCGGCAGGAGATAT
TGGCATACAGTATATGATCCATGCCATTATCTGCATGGTTGTCATAACAGGCATTTTCAAAACTATCCCC
ACGACTGTAGCTAGTTTTGTAACAAATGCAGGAATAGGTTCCAACCCAATCGGTGCTGTTGTTGCCACTG
TGGCGGGTGTTGCAGCTACAGGAAAAATGGCTGGCGCTAGTTCCAAAAAAGCTGGGGCAGTTGCTGCAGC
AGCAGGAATGGTGAGCGGGGGCGTTGGAACAGCGGCAATGGCAGCTGGAAAAATGGCTGCTACGGCCACT
GTTGGTTCCAAAATGGCTGGTGCTGGTCAAGCTGCTGCGTCTTTAGGAAAAGGCATAAATAGTGCTGGTC
AAGCAGCTAAGACAGCAGGATCAATAACAGGATCAGTACTCAAGGGAAATGCTGGTGAAGTAAAGAGCAA
AGCATCTGAGATTATCAATAAGATGAAGAAATAA
 Primer design