SecReT4
Protein ID: 51246988
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB17
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]19288..19953 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ6AIG6
KEGG IDdps:DPPB17
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-41, Aligned region: 15..217
Protein Sequence: 221 a.a.     [Download]
>gi|51246988|ref|YP_066871.1| conjugal transfer protein TrbF [Desulfotalea psychrophila LSv54]
MSEKGTMSNPYLIGRQAWAEENGSIINSRNNWRSCGFIALALLSFSLFINYYQATQAKLIPYLLEVDKAG
NMYARGVAHTYTKLPRSVIEGSIISFITEWRTVSADLGLQKKYVQQTNYRSAGSATGILGEWYSENNPYK
LAETNLVDIKIQGVPLVISKNSWQIEWIETTRNHNGVTQYTTIYQANVQIQLKAPTTEREVLKNATGVFV
TSLSWTKKLNQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|51246971|ref|NC_006139.1|:19288-19953 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGTCAGAAAAAGGCACTATGTCGAATCCGTACTTAATTGGTCGTCAAGCATGGGCCGAGGAAAACGGAT
CAATTATCAATAGTCGTAACAACTGGCGATCCTGCGGCTTTATAGCACTTGCCCTCCTGTCTTTTAGTTT
ATTTATAAACTATTACCAAGCGACACAAGCAAAACTTATACCATACCTGCTAGAGGTAGATAAGGCTGGA
AACATGTATGCAAGAGGTGTTGCCCATACATACACTAAATTACCCAGATCGGTTATTGAGGGCAGCATTA
TCTCCTTTATTACCGAATGGAGAACAGTCTCAGCAGACCTTGGTTTACAGAAAAAATATGTCCAACAAAC
CAATTACAGATCAGCAGGATCTGCAACAGGGATTTTGGGAGAATGGTATTCCGAGAACAACCCTTATAAA
CTAGCCGAAACCAATCTTGTCGATATTAAAATACAAGGTGTTCCGCTAGTTATTTCAAAAAACTCTTGGC
AAATTGAATGGATCGAAACCACCAGAAATCATAATGGTGTTACTCAATATACAACCATTTACCAAGCCAA
CGTGCAAATACAACTAAAGGCACCAACCACCGAGAGAGAAGTTTTAAAAAACGCCACTGGTGTTTTCGTG
ACAAGTCTTTCTTGGACTAAAAAACTAAATCAATAA
 Primer design