SecReT4
Protein ID: 51246989
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB18
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]19963..20949 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ6AIG5
KEGG IDdps:DPPB18
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.5e-47, Aligned region: 111..325
Protein Sequence: 328 a.a.     [Download]
>gi|51246989|ref|YP_066872.1| conjugal transfer protein TrbG [Desulfotalea psychrophila LSv54]
MKKITSFLRQIGCYSVLATALTFHVTAALAVTPEQKQTPIAQASTTDETKPIRIVRIQAPDTISNRSLPK
FTSQRSATLTSQEKEALRLAKNWNRKTLKPIMKNGGRVSYVYGAIIPTIICTPFKIADLELEKGEIVNNI
LLGDTARWDAELVLAGTGADATPHITFKAIDSGLETSAIIGTNRRAYHLNLKSDKKKHTPYSGFIYAKPT
KKILASIQHKLEDKVERNKTAEGFDISQLDFKYSIEGKASWRPVQVYSNGLKTYIKMPKSINQVELPVLM
VATPEGNGLVNYRVKNDTFIIDQLFKKAVLIAGVGSKQEKVSIKRGEK
 
Nucleotide Sequence: 987 bp     [Download]
>gi|51246971|ref|NC_006139.1|:19963-20949 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGAAAAAGATCACATCATTTTTAAGACAGATAGGGTGCTATAGTGTCCTGGCTACAGCTTTAACTTTCC
ACGTAACAGCTGCACTTGCTGTTACACCAGAACAAAAACAAACTCCAATAGCACAAGCTTCGACCACGGA
CGAAACAAAGCCCATAAGAATAGTGAGGATTCAAGCACCTGACACGATAAGTAATCGTTCCCTACCCAAA
TTTACAAGCCAGCGCTCTGCGACTCTAACATCTCAAGAAAAAGAGGCTCTTAGATTAGCCAAAAACTGGA
ACAGGAAAACATTAAAACCAATCATGAAAAATGGTGGTCGGGTTTCTTATGTCTACGGCGCAATCATCCC
GACAATCATTTGCACGCCCTTTAAAATTGCAGATCTTGAGCTTGAAAAAGGGGAAATTGTAAACAACATT
TTATTAGGTGACACAGCTAGATGGGACGCGGAGCTAGTACTAGCTGGCACAGGTGCAGATGCAACCCCAC
ACATCACCTTTAAGGCCATAGACTCAGGTCTTGAGACATCAGCAATTATTGGAACTAACAGGCGAGCTTA
TCACTTAAACCTGAAATCAGATAAAAAAAAGCACACTCCATATTCAGGCTTTATTTATGCTAAACCAACC
AAAAAAATTCTTGCCTCAATTCAACATAAACTGGAAGACAAAGTAGAACGCAACAAAACCGCCGAAGGTT
TTGATATATCACAATTAGATTTTAAATATTCAATTGAAGGAAAAGCGTCTTGGCGACCTGTGCAGGTTTA
TAGCAATGGCCTTAAAACTTATATAAAAATGCCTAAAAGTATAAATCAAGTTGAATTGCCTGTTTTGATG
GTTGCGACCCCAGAAGGAAATGGCCTCGTAAATTACAGAGTTAAAAATGATACATTCATTATTGACCAGC
TATTTAAAAAAGCTGTGCTTATTGCAGGAGTTGGTAGCAAACAAGAAAAGGTTTCAATTAAACGAGGTGA
AAAATAA
 Primer design