SecReT4
Protein ID: 51246991
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB20
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]21388..22635 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ6AIG3
KEGG IDdps:DPPB20
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-59, Aligned region: 218..407
Protein Sequence: 415 a.a.     [Download]
>gi|51246991|ref|YP_066874.1| conjugal transfer protein TrbI [Desulfotalea psychrophila LSv54]
MSDNPTGLKPTPQGTWLSKKPLFFAATVGAIMLLIMLYSINGNKKVEREAEQSVVTIETTEEQTKADYGV
ASLPTPPNEAGTIRAAKSTAAPLLPAKPITVITQRQKTQVEIQHEKELAKVREWKITNQLKALNSPLIEK
KITGNESNFSSTLPSTPSASTSGGGGANARFDQLKNQLAKVQNGSATPAQPLKSSSGLTSKPSQWTSQYT
REAGAQFELKTGTVIPALMLTGINSQLAGEITGQVSQNIYDTATGQYLIIPQGTRISGNYASDVQVGQER
LFVVWKRLVFPDGSSVTLDGLQGVDYAGYTGLKDQVDNHYAKIFGNAIVMSLITGGSAYAIDSLNDNGNN
DDRNRRITIQSELGTAVATQLSQTGLALLQRNMNIAPTIKIRPGYRFNVMVVKDMVFDEPYEGWR
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|51246971|ref|NC_006139.1|:21388-22635 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGAGTGACAACCCAACTGGCCTCAAGCCTACGCCACAAGGCACTTGGCTTAGTAAAAAACCACTTTTTT
TTGCTGCTACTGTTGGAGCCATAATGCTTCTCATTATGCTGTACTCCATCAACGGAAACAAAAAAGTAGA
GCGCGAGGCCGAGCAATCTGTAGTTACGATTGAAACAACAGAAGAGCAAACAAAAGCAGATTACGGGGTA
GCGTCATTACCTACCCCACCAAACGAAGCGGGAACAATCAGGGCTGCTAAATCTACAGCTGCACCACTGT
TACCAGCAAAACCGATAACCGTTATAACCCAGAGACAAAAAACACAGGTCGAAATTCAGCATGAAAAAGA
ACTGGCAAAAGTTAGAGAGTGGAAGATTACCAATCAACTCAAGGCACTTAATTCTCCGCTGATCGAGAAA
AAAATAACAGGAAATGAATCAAATTTCAGCTCAACTCTTCCATCTACTCCATCGGCCTCGACCTCGGGTG
GTGGCGGTGCTAATGCAAGATTTGACCAGTTAAAAAATCAGCTTGCGAAAGTGCAGAATGGTTCGGCAAC
ACCTGCTCAACCACTAAAAAGCTCATCGGGTTTAACCTCAAAACCATCACAATGGACATCTCAGTATACG
AGGGAGGCAGGAGCACAATTTGAGCTAAAAACAGGTACGGTAATCCCCGCCCTAATGCTCACTGGTATCA
ACTCGCAACTTGCCGGCGAAATTACGGGCCAGGTATCGCAAAATATTTACGACACGGCCACAGGCCAGTA
TCTCATAATCCCCCAGGGAACCAGGATTTCCGGCAACTACGCTTCCGATGTCCAGGTGGGCCAGGAACGA
CTTTTCGTCGTTTGGAAAAGACTCGTCTTCCCTGACGGCTCAAGCGTTACCCTCGACGGCTTACAGGGCG
TTGACTATGCGGGATACACTGGACTTAAAGATCAAGTTGACAATCATTATGCCAAGATTTTTGGCAATGC
CATTGTTATGTCGCTTATCACCGGGGGATCGGCATATGCCATTGATAGCCTAAATGATAATGGAAACAAC
GATGACCGTAATCGTCGCATCACTATACAGAGCGAGCTTGGAACAGCAGTAGCAACTCAACTCAGCCAAA
CGGGTTTGGCATTGTTACAGCGCAATATGAACATTGCGCCCACTATCAAGATTCGACCCGGGTACCGCTT
TAATGTGATGGTTGTAAAAGACATGGTTTTCGATGAACCCTACGAGGGATGGAGATAG
 Primer design