SecReT4
Protein ID: 51246995
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB24
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]26445..26861 [+]
ProductTraG protein, C-terminal part
Component typeTraG
UniProt IDQ6AIF9
KEGG IDdps:DPPB24
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-22, Aligned region: 3..116
TraG-D_C [PF12696], Evalue: 2e-13, Aligned region: 1..69
TrwB_AAD_bind [PF10412], Evalue: 0.0001, Aligned region: 2..69
Protein Sequence: 138 a.a.     [Download]
>gi|51246995|ref|YP_066878.1| TraG protein, C-terminal part, partial [Desulfotalea psychrophila LSv54]
MSNCHIRIAYAPNGIETAKTLSEMLGKTTVVQKKTSISGKRSGRLSNASMSIQEVARDLLTADECMRLPA
PLKDSKGNILESGHMLIFVAGANPIYGKQILYFKDPVFLERAKLPTPENDSSSKNLSDIFNQKLTCAQ
 
Nucleotide Sequence: 417 bp     [Download]
>gi|51246971|ref|NC_006139.1|:26445-26861 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGTCAAACTGCCACATTCGGATCGCTTACGCCCCCAATGGCATTGAGACAGCAAAAACTCTTTCGGAGA
TGCTTGGTAAAACCACAGTTGTACAAAAGAAAACATCCATATCGGGTAAAAGATCAGGCCGGCTGTCGAA
CGCCAGTATGAGTATCCAGGAGGTTGCCAGAGATCTACTTACAGCTGATGAGTGCATGAGACTACCCGCC
CCACTCAAGGACAGTAAAGGCAATATTCTCGAATCGGGGCACATGCTCATCTTTGTTGCCGGCGCCAATC
CTATCTACGGTAAACAAATCCTCTACTTTAAAGATCCTGTTTTTCTGGAACGGGCAAAATTACCAACTCC
CGAAAATGACAGCTCATCAAAAAACCTTAGCGATATCTTCAATCAAAAACTCACCTGTGCCCAATGA
 Primer design