SecReT4
Protein ID: 51246996
T4SS name [ID]Trb [458]
Gene symbol-
Locus tagDPPB25
StrainDesulfotalea psychrophila LSv54
Repliconplasmid large [GenBank: NC_006139] [Browse all T4SS(s) in this replicon]
Location [Strand]26858..27307 [+]
Productconjugal transfer protein TraF precursor
Component typeTraF
UniProt IDQ6AIF8
KEGG IDdps:DPPB25
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.9e-23, Aligned region: 24..148
Protein Sequence: 149 a.a.     [Download]
>gi|51246996|ref|YP_066879.1| conjugal transfer protein TraF precursor [Desulfotalea psychrophila LSv54]
MKKLIFFCLSILLIIFIGNEFCYINITKSLPLGIYRTIKSPPTYGSCVVFKLPEDNPMAELAIRRGYAKE
DQPFLKRVAYLEGDSYNLPETEEFDSRGRKMEPFKPSSGYVAKGMIVVRGDSSTSFDSRYFGPIYAKNIE
AIVKPLLTW
 
Nucleotide Sequence: 450 bp     [Download]
>gi|51246971|ref|NC_006139.1|:26858-27307 Desulfotalea psychrophila LSv54 plasmid large, complete sequence
ATGAAAAAACTTATCTTCTTCTGCCTTAGCATCCTCTTGATCATTTTTATAGGCAATGAATTTTGTTACA
TCAACATAACAAAATCACTACCTCTGGGAATATACAGAACGATTAAGAGCCCACCCACATACGGCTCCTG
CGTAGTTTTCAAATTACCTGAAGACAACCCCATGGCAGAGCTTGCTATAAGAAGAGGATACGCAAAAGAA
GACCAGCCCTTCCTGAAGAGGGTAGCTTACCTGGAAGGCGATTCTTACAACCTTCCTGAAACAGAGGAGT
TTGATTCAAGGGGCCGAAAAATGGAACCCTTCAAACCGTCTTCTGGTTATGTAGCCAAGGGAATGATCGT
GGTGCGGGGTGATTCTTCAACCAGTTTTGATTCAAGGTATTTTGGTCCCATCTATGCGAAAAACATCGAG
GCGATAGTTAAGCCTCTTTTGACATGGTAA
 Primer design