SecReT4
Protein ID: 51473241
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0028
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]29679..33143 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX6
KEGG IDrty:RT0028
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-25, Aligned region: 294..483
Protein Sequence: 1154 a.a.     [Download]
>gi|51473241|ref|YP_066998.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKRNIFIKLLISLLLLSSCTGDTCIDPDDFGFIKFNVSSRYNPEEITSRHEGDQVAPWRDSAYKVNGYPL
TIMVRPWNYILGDKNTSGQLSAWCPWYGQKNNTTTLAPFCIKLQPCTFWDNTRLDMCTPNPENRNDAMIS
NPPCIMTDGVGLYFLIAAKNTDPNISPDSQRKPQGITRHLGELTSSVGYEFYSISSTGQLLKAGGINYQY
NGEDKSKYAQSPLYFKIIDKFYDDNSGQYRLVIKSGVSDTRPDPLQFLTDLIKDVLFGKNGIIKKTYQQI
VDTPGYRISVSAILTLYIMFTGLSFLIGNINLTHVELIIRIFKISIISILLSSDKAWTFFHDYLFVFFID
GVQQILQIINEAAATGPGSQSLLGLLISTQTLSKLFSLLFVDWLGFIYIILYLIALYFIFFLIFKATIIY
LTALITIGMMIIMGPIFICFMLFNITRSLFENWLRQLISYALQPIILFAGIAFISMIIRTEIYSTLGFGV
CKHDFPNLGPINEIFGSFLEDIDPSLSNSIFYWWFPVPMKGGINNFHKAKILVPNDHIVVDDSCKNNHDK
CKHCAAYECIDERYIELPFLDLVKDSTRINNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGT
SGNLTDIQKVNQQSYESVSQQINRPLNYVAKTISTPVTSRISAGTAQANMFFAEKFENMMMRRLEKQALS
SSANKVVQNEVKRKYGIDSKDVNMNAIKDYEDGISRLLNNLPKGNELKVKELSQMKFTQLRDKISANKYD
VQDYTTLSTEQKTELDKLLKDANLRVLASDANFTKDYQEAYKHAHQEMSGRGIGLFGKNIGVLRSWQEME
HSINVKRKLKEEKRIGIGEKIYAGYTGIKRAALTTIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEK
LKDDEKAREREKLRMHINKETLAVQADILSPEYLVKLEKAGRKSDVEYYQELAQRQLIYDVHSKLFEEGE
PVMMGDRFMREKATDSQMRDMIDNAHKKYVELIDVDRYTRRQEYYDIIYEKAKENLEQTYKEVQDHFKRD
NISIEEMPALIAQKVKDTNAGSEIDKKITEELNNFNADVKNYEYSTAVLNKIEDRKQTITDVVNVQIDKI
NKYRENAKMEQYVKPILNEGRKLRTLEDHFKNMK
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c33143-29679 Rickettsia typhi str. Wilmington, complete genome
ATGAAAAGAAATATTTTTATTAAATTATTAATATCACTATTGTTGCTTTCTAGTTGTACAGGCGATACTT
GTATTGATCCTGATGATTTCGGTTTCATCAAATTCAATGTCTCTTCTAGATATAATCCGGAAGAAATTAC
TTCAAGACATGAAGGTGATCAAGTTGCACCATGGCGTGATAGTGCTTATAAAGTAAACGGTTATCCTTTA
ACCATTATGGTAAGACCGTGGAATTATATACTTGGCGATAAAAATACCTCAGGTCAGTTATCTGCATGGT
GTCCATGGTATGGTCAAAAAAATAACACAACTACTTTGGCTCCTTTTTGCATTAAACTACAACCATGTAC
TTTCTGGGATAATACTAGACTTGATATGTGTACTCCTAATCCAGAAAATCGTAATGATGCAATGATTAGT
AATCCTCCATGTATAATGACAGATGGTGTGGGGCTTTATTTTCTTATTGCAGCTAAAAATACTGATCCTA
ATATTTCACCTGATTCACAGCGTAAACCACAAGGTATAACAAGACATTTAGGAGAACTTACTTCAAGTGT
AGGCTATGAATTCTATAGTATTAGTAGTACAGGACAACTCTTGAAAGCAGGTGGAATAAATTATCAATAT
AATGGTGAGGATAAGTCAAAATATGCTCAATCTCCTCTTTATTTTAAGATTATAGATAAATTTTATGATG
ATAATAGTGGACAGTATAGATTAGTAATAAAGTCTGGGGTTAGTGATACAAGACCAGATCCGCTACAATT
TTTAACAGATTTAATAAAAGACGTATTATTTGGTAAAAATGGAATTATAAAGAAAACTTATCAACAAATA
GTTGATACACCAGGTTATAGGATAAGTGTCTCAGCTATTTTAACTCTATATATAATGTTTACAGGTTTAT
CATTTTTAATAGGTAATATAAATCTTACTCATGTTGAACTTATAATTAGAATCTTTAAAATTAGTATCAT
TTCAATATTATTAAGTTCGGATAAAGCTTGGACATTTTTTCATGATTATTTATTCGTATTTTTTATTGAT
GGTGTGCAGCAAATATTGCAAATAATTAATGAAGCTGCAGCTACTGGTCCAGGTTCTCAAAGTTTGCTTG
GGTTACTTATTTCTACTCAAACTTTATCTAAATTATTTTCTTTACTGTTTGTTGATTGGCTCGGTTTTAT
ATATATCATTCTATATTTAATAGCATTATATTTTATTTTTTTTCTTATATTTAAAGCTACTATTATATAT
CTAACAGCGCTTATCACTATTGGTATGATGATAATTATGGGACCGATATTTATTTGTTTCATGTTGTTTA
ATATAACTCGTTCGTTATTTGAGAATTGGTTAAGACAATTAATATCATATGCATTACAGCCTATAATTTT
ATTTGCTGGTATCGCTTTTATTTCAATGATCATCAGAACTGAAATATATTCAACACTTGGTTTTGGAGTA
TGTAAACATGATTTTCCTAATTTAGGTCCGATCAATGAAATATTCGGTAGCTTCCTTGAGGATATAGATC
CGAGTCTTAGTAATTCGATATTTTATTGGTGGTTCCCTGTGCCAATGAAAGGTGGTATAAATAATTTTCA
CAAAGCAAAGATATTAGTACCTAACGATCATATAGTAGTAGATGATTCTTGTAAGAATAACCATGATAAA
TGTAAGCATTGTGCTGCGTATGAGTGTATAGATGAACGTTATATTGAATTACCGTTTTTAGATTTAGTTA
AAGATTCCACAAGGATTAATAATTTTATAAATGGTAAATTTGTTCAACTTGATGGGATATTACTAATTTT
TGTTTCCATTTATTTATTAAGTAAATTTAATGATACTGCTATATCTACGGCACAATTTATTGCAGGTACT
TCAGGTAATTTAACAGATATACAAAAAGTTAATCAACAATCTTATGAATCTGTATCGCAGCAAATCAACA
GACCGTTAAATTATGTTGCTAAGACTATAAGTACACCTGTAACTAGTCGTATAAGTGCAGGGACAGCACA
GGCTAATATGTTCTTTGCTGAGAAATTTGAAAATATGATGATGAGGAGGCTTGAAAAACAAGCGCTCAGC
TCTTCAGCAAATAAAGTTGTACAAAATGAGGTTAAAAGAAAATATGGTATAGATTCTAAAGATGTAAACA
TGAATGCCATTAAGGATTATGAAGATGGTATTTCAAGATTATTAAATAATTTACCTAAAGGGAATGAATT
AAAAGTAAAAGAATTATCGCAAATGAAATTTACTCAACTCCGAGATAAAATTTCTGCAAACAAATATGAT
GTACAAGATTACACTACTTTAAGTACAGAACAAAAAACAGAACTTGATAAGTTATTAAAAGATGCTAACT
TACGTGTGCTTGCTAGCGATGCAAATTTTACTAAAGATTATCAAGAAGCTTATAAGCATGCTCACCAAGA
AATGTCAGGGCGAGGTATTGGGCTGTTTGGTAAGAACATAGGAGTGCTTAGAAGTTGGCAAGAGATGGAG
CATAGTATTAATGTCAAACGTAAATTAAAAGAAGAAAAACGTATAGGTATAGGCGAAAAAATATATGCAG
GTTATACAGGAATAAAAAGAGCAGCTTTAACTACAATAGTAGGTAAAGATTTACGTGATGCTTATGAAGG
TAATCTAACCAGTGCTGAATGGCATGATTTTGAATATAACGACCCAAGATTGAGAACTTATAGTGAAAAA
TTAAAAGATGATGAAAAAGCACGAGAACGTGAAAAGTTACGAATGCATATTAATAAAGAAACACTAGCTG
TCCAAGCAGATATATTATCACCGGAATATCTAGTAAAGCTAGAAAAAGCAGGTAGAAAAAGTGATGTTGA
ATATTATCAAGAATTAGCTCAAAGACAGCTTATTTATGACGTGCATAGTAAGTTATTTGAGGAAGGTGAA
CCTGTAATGATGGGTGATAGATTTATGCGTGAAAAAGCTACTGATTCTCAGATGCGTGATATGATAGATA
ACGCTCATAAAAAATATGTAGAATTGATAGATGTAGATCGATACACTCGTCGTCAAGAGTATTATGATAT
TATCTATGAAAAAGCTAAAGAAAATTTAGAACAAACTTATAAAGAAGTTCAAGATCATTTCAAAAGAGAT
AATATAAGCATTGAAGAAATGCCGGCATTAATCGCACAAAAAGTTAAAGATACAAATGCAGGATCTGAAA
TAGACAAAAAAATTACTGAAGAGCTCAATAATTTTAATGCTGATGTTAAAAATTATGAATATAGTACCGC
AGTGTTAAATAAAATAGAGGATAGAAAGCAAACTATTACGGATGTAGTAAATGTTCAGATTGATAAGATT
AACAAATATAGAGAAAATGCTAAAATGGAGCAATATGTAAAACCAATATTAAATGAAGGAAGAAAACTAA
GGACATTAGAAGATCATTTTAAAAATATGAAGTAG
 Primer design