SecReT4
Protein ID: 51473241
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0028
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]29679..33143 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX6
KEGG IDrty:RT0028
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-25, Aligned region: 294..483
Protein Sequence: 1154 a.a.     [Download]
>gi|51473241|ref|YP_066998.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKRNIFIKLLISLLLLSSCTGDTCIDPDDFGFIKFNVSSRYNPEEITSRHEGDQVAPWRDSAYKVNGYPL
TIMVRPWNYILGDKNTSGQLSAWCPWYGQKNNTTTLAPFCIKLQPCTFWDNTRLDMCTPNPENRNDAMIS
NPPCIMTDGVGLYFLIAAKNTDPNISPDSQRKPQGITRHLGELTSSVGYEFYSISSTGQLLKAGGINYQY
NGEDKSKYAQSPLYFKIIDKFYDDNSGQYRLVIKSGVSDTRPDPLQFLTDLIKDVLFGKNGIIKKTYQQI
VDTPGYRISVSAILTLYIMFTGLSFLIGNINLTHVELIIRIFKISIISILLSSDKAWTFFHDYLFVFFID
GVQQILQIINEAAATGPGSQSLLGLLISTQTLSKLFSLLFVDWLGFIYIILYLIALYFIFFLIFKATIIY
LTALITIGMMIIMGPIFICFMLFNITRSLFENWLRQLISYALQPIILFAGIAFISMIIRTEIYSTLGFGV
CKHDFPNLGPINEIFGSFLEDIDPSLSNSIFYWWFPVPMKGGINNFHKAKILVPNDHIVVDDSCKNNHDK
CKHCAAYECIDERYIELPFLDLVKDSTRINNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGT
SGNLTDIQKVNQQSYESVSQQINRPLNYVAKTISTPVTSRISAGTAQANMFFAEKFENMMMRRLEKQALS
SSANKVVQNEVKRKYGIDSKDVNMNAIKDYEDGISRLLNNLPKGNELKVKELSQMKFTQLRDKISANKYD
VQDYTTLSTEQKTELDKLLKDANLRVLASDANFTKDYQEAYKHAHQEMSGRGIGLFGKNIGVLRSWQEME
HSINVKRKLKEEKRIGIGEKIYAGYTGIKRAALTTIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEK
LKDDEKAREREKLRMHINKETLAVQADILSPEYLVKLEKAGRKSDVEYYQELAQRQLIYDVHSKLFEEGE
PVMMGDRFMREKATDSQMRDMIDNAHKKYVELIDVDRYTRRQEYYDIIYEKAKENLEQTYKEVQDHFKRD
NISIEEMPALIAQKVKDTNAGSEIDKKITEELNNFNADVKNYEYSTAVLNKIEDRKQTITDVVNVQIDKI
NKYRENAKMEQYVKPILNEGRKLRTLEDHFKNMK
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c33143-29679 Rickettsia typhi str. Wilmington, complete genome
ATGAAAAGAAATATTTTTATTAAATTATTAATATCACTATTGTTGCTTTCTAGTTGTACAGGCGATACTT
GTATTGATCCTGATGATTTCGGTTTCATCAAATTCAATGTCTCTTCTAGATATAATCCGGAAGAAATTAC
TTCAAGACATGAAGGTGATCAAGTTGCACCATGGCGTGATAGTGCTTATAAAGTAAACGGTTATCCTTTA
ACCATTATGGTAAGACCGTGGAATTATATACTTGGCGATAAAAATACCTCAGGTCAGTTATCTGCATGGT
GTCCATGGTATGGTCAAAAAAATAACACAACTACTTTGGCTCCTTTTTGCATTAAACTACAACCATGTAC
TTTCTGGGATAATACTAGACTTGATATGTGTACTCCTAATCCAGAAAATCGTAATGATGCAATGATTAGT
AATCCTCCATGTATAATGACAGATGGTGTGGGGCTTTATTTTCTTATTGCAGCTAAAAATACTGATCCTA
ATATTTCACCTGATTCACAGCGTAAACCACAAGGTATAACAAGACATTTAGGAGAACTTACTTCAAGTGT
AGGCTATGAATTCTATAGTATTAGTAGTACAGGACAACTCTTGAAAGCAGGTGGAATAAATTATCAATAT
AATGGTGAGGATAAGTCAAAATATGCTCAATCTCCTCTTTATTTTAAGATTATAGATAAATTTTATGATG
ATAATAGTGGACAGTATAGATTAGTAATAAAGTCTGGGGTTAGTGATACAAGACCAGATCCGCTACAATT
TTTAACAGATTTAATAAAAGACGTATTATTTGGTAAAAATGGAATTATAAAGAAAACTTATCAACAAATA
GTTGATACACCAGGTTATAGGATAAGTGTCTCAGCTATTTTAACTCTATATATAATGTTTACAGGTTTAT
CATTTTTAATAGGTAATATAAATCTTACTCATGTTGAACTTATAATTAGAATCTTTAAAATTAGTATCAT
TTCAATATTATTAAGTTCGGATAAAGCTTGGACATTTTTTCATGATTATTTATTCGTATTTTTTATTGAT
GGTGTGCAGCAAATATTGCAAATAATTAATGAAGCTGCAGCTACTGGTCCAGGTTCTCAAAGTTTGCTTG
GGTTACTTATTTCTACTCAAACTTTATCTAAATTATTTTCTTTACTGTTTGTTGATTGGCTCGGTTTTAT
ATATATCATTCTATATTTAATAGCATTATATTTTATTTTTTTTCTTATATTTAAAGCTACTATTATATAT
CTAACAGCGCTTATCACTATTGGTATGATGATAATTATGGGACCGATATTTATTTGTTTCATGTTGTTTA
ATATAACTCGTTCGTTATTTGAGAATTGGTTAAGACAATTAATATCATATGCATTACAGCCTATAATTTT
ATTTGCTGGTATCGCTTTTATTTCAATGATCATCAGAACTGAAATATATTCAACACTTGGTTTTGGAGTA
TGTAAACATGATTTTCCTAATTTAGGTCCGATCAATGAAATATTCGGTAGCTTCCTTGAGGATATAGATC
CGAGTCTTAGTAATTCGATATTTTATTGGTGGTTCCCTGTGCCAATGAAAGGTGGTATAAATAATTTTCA
CAAAGCAAAGATATTAGTACCTAACGATCATATAGTAGTAGATGATTCTTGTAAGAATAACCATGATAAA
TGTAAGCATTGTGCTGCGTATGAGTGTATAGATGAACGTTATATTGAATTACCGTTTTTAGATTTAGTTA
AAGATTCCACAAGGATTAATAATTTTATAAATGGTAAATTTGTTCAACTTGATGGGATATTACTAATTTT
TGTTTCCATTTATTTATTAAGTAAATTTAATGATACTGCTATATCTACGGCACAATTTATTGCAGGTACT
TCAGGTAATTTAACAGATATACAAAAAGTTAATCAACAATCTTATGAATCTGTATCGCAGCAAATCAACA
GACCGTTAAATTATGTTGCTAAGACTATAAGTACACCTGTAACTAGTCGTATAAGTGCAGGGACAGCACA
GGCTAATATGTTCTTTGCTGAGAAATTTGAAAATATGATGATGAGGAGGCTTGAAAAACAAGCGCTCAGC
TCTTCAGCAAATAAAGTTGTACAAAATGAGGTTAAAAGAAAATATGGTATAGATTCTAAAGATGTAAACA
TGAATGCCATTAAGGATTATGAAGATGGTATTTCAAGATTATTAAATAATTTACCTAAAGGGAATGAATT
AAAAGTAAAAGAATTATCGCAAATGAAATTTACTCAACTCCGAGATAAAATTTCTGCAAACAAATATGAT
GTACAAGATTACACTACTTTAAGTACAGAACAAAAAACAGAACTTGATAAGTTATTAAAAGATGCTAACT
TACGTGTGCTTGCTAGCGATGCAAATTTTACTAAAGATTATCAAGAAGCTTATAAGCATGCTCACCAAGA
AATGTCAGGGCGAGGTATTGGGCTGTTTGGTAAGAACATAGGAGTGCTTAGAAGTTGGCAAGAGATGGAG
CATAGTATTAATGTCAAACGTAAATTAAAAGAAGAAAAACGTATAGGTATAGGCGAAAAAATATATGCAG
GTTATACAGGAATAAAAAGAGCAGCTTTAACTACAATAGTAGGTAAAGATTTACGTGATGCTTATGAAGG
TAATCTAACCAGTGCTGAATGGCATGATTTTGAATATAACGACCCAAGATTGAGAACTTATAGTGAAAAA
TTAAAAGATGATGAAAAAGCACGAGAACGTGAAAAGTTACGAATGCATATTAATAAAGAAACACTAGCTG
TCCAAGCAGATATATTATCACCGGAATATCTAGTAAAGCTAGAAAAAGCAGGTAGAAAAAGTGATGTTGA
ATATTATCAAGAATTAGCTCAAAGACAGCTTATTTATGACGTGCATAGTAAGTTATTTGAGGAAGGTGAA
CCTGTAATGATGGGTGATAGATTTATGCGTGAAAAAGCTACTGATTCTCAGATGCGTGATATGATAGATA
ACGCTCATAAAAAATATGTAGAATTGATAGATGTAGATCGATACACTCGTCGTCAAGAGTATTATGATAT
TATCTATGAAAAAGCTAAAGAAAATTTAGAACAAACTTATAAAGAAGTTCAAGATCATTTCAAAAGAGAT
AATATAAGCATTGAAGAAATGCCGGCATTAATCGCACAAAAAGTTAAAGATACAAATGCAGGATCTGAAA
TAGACAAAAAAATTACTGAAGAGCTCAATAATTTTAATGCTGATGTTAAAAATTATGAATATAGTACCGC
AGTGTTAAATAAAATAGAGGATAGAAAGCAAACTATTACGGATGTAGTAAATGTTCAGATTGATAAGATT
AACAAATATAGAGAAAATGCTAAAATGGAGCAATATGTAAAACCAATATTAAATGAAGGAAGAAAACTAA
GGACATTAGAAGATCATTTTAAAAATATGAAGTAG
 Primer design

Protein ID: 51473242
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0029
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]33268..35928 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX5
KEGG IDrty:RT0029
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-20, Aligned region: 516..710
Protein Sequence: 886 a.a.     [Download]
>gi|51473242|ref|YP_066999.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKILKSLVLLVLFIVMPAKAHDTFSWMSTSFSGLKGLFGCLEVPEFTSFQESNIGINLSKAGTWQSTGHT
VEKGKLLKINWSIAGVTTEPRKYLVLYRIDPRFSTPQVFIKTYNYSKLQFEALGFPRFVTNSNSSIPGAI
PPDKELDALSFTKMSDSIKYYARNNVKIEVKAGDVVNISLVSKDNFFTSNTLDNILTEELDSSIFAASAL
YTQSNLGNFDNRIIYASAKEVCDIIDPSRDPNKPSGCSGTGATTKYKSINSNEALVGKPMMIGAVHNFMG
LINSCPEHSGINTRPACYYDQGRGMIIKVGGQVIKGRDQSFVKSGRNSFIYYQATRNGIMDFTSDWQVNN
MFSNSVLMSDWIRRFLNYPSFIDYINKNDWSANFLYFGRYSMIVEIGNGANSISSDVQQNINLEYLITYD
GTLPDPSIRGTPVDYNFSADAPKDGYLWLRVVNPNSNIQGVVSVNYANYTGTTWFSDIVYNGAIKPITDQ
FRTFSKNFYIKLIKNSAVQNIAKGSLTLYVIIFGLMFVAGTLKLTAIEVITRICKIAIVAFLIREESWSF
FNTYFFSVFTDGIDFFITNVVGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIY
SLITYFRAILEVIIGYIIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQPTILLIFFLLI
DQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLSIPINFSFTLPFLPGIPFYVPDVPEINRSNIFNNNTNT
FLVLFTTALLFYVYCLMSYGLVTFVNIVVGMLTNVTPARISGNYQARSDPVGAVMQDIGSVTTPIKNASM
VPARIFKDKIIDQNYKAKKLEGGVEFTNKFFAKRNDVTKKEEGVRE
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c35928-33268 Rickettsia typhi str. Wilmington, complete genome
ATGAAAATTCTTAAGAGTTTAGTTTTATTAGTTTTGTTTATTGTAATGCCAGCTAAAGCTCATGATACTT
TTTCATGGATGTCAACTAGTTTTAGTGGATTAAAAGGCTTATTCGGTTGTTTAGAAGTACCTGAATTTAC
AAGTTTTCAAGAAAGTAATATAGGAATTAATTTATCTAAAGCAGGGACTTGGCAATCAACAGGTCATACT
GTTGAGAAAGGTAAATTGTTAAAAATAAATTGGTCTATTGCAGGTGTTACTACTGAACCTAGAAAATATC
TAGTATTATATAGAATTGATCCAAGATTTAGTACACCTCAAGTTTTTATTAAAACTTATAATTATTCGAA
ATTACAATTTGAAGCTTTAGGATTCCCTCGTTTTGTTACGAACAGTAACAGTTCAATACCTGGAGCTATA
CCACCCGATAAAGAGCTTGATGCACTTTCATTTACTAAAATGTCTGATTCTATAAAATATTATGCTAGAA
ATAATGTAAAAATTGAAGTTAAGGCTGGTGATGTAGTAAATATTAGTTTAGTTAGTAAAGATAATTTTTT
TACTTCTAATACTCTAGATAATATTTTAACAGAAGAACTTGATAGTTCAATATTTGCTGCTTCTGCACTT
TATACTCAAAGTAACCTTGGAAATTTTGATAATAGAATAATTTATGCATCTGCAAAAGAGGTATGTGATA
TTATAGATCCTTCAAGAGATCCTAATAAACCAAGTGGATGTAGCGGTACTGGTGCAACTACAAAATATAA
AAGTATAAATAGTAATGAAGCATTAGTTGGCAAACCTATGATGATTGGGGCGGTACATAATTTCATGGGA
TTAATTAATTCTTGCCCTGAGCACTCCGGTATAAATACTAGACCTGCTTGCTATTATGATCAAGGTAGAG
GGATGATAATTAAAGTAGGGGGACAGGTTATTAAGGGACGAGATCAGAGTTTTGTAAAATCAGGCAGAAA
TAGCTTTATATATTATCAAGCGACTAGGAATGGTATTATGGATTTTACTAGTGATTGGCAAGTTAATAAT
ATGTTTAGTAATTCAGTTTTAATGAGTGATTGGATTAGACGTTTTTTAAATTATCCTAGTTTTATAGATT
ATATCAATAAGAATGATTGGTCAGCTAATTTTTTATATTTTGGTCGTTATTCGATGATTGTTGAAATAGG
TAATGGGGCTAATTCAATTAGTTCTGATGTCCAACAAAATATAAATTTAGAATATTTAATAACATATGAT
GGTACATTACCTGATCCATCTATTCGTGGTACACCGGTAGATTATAATTTTTCAGCTGATGCACCGAAAG
ATGGCTATTTATGGTTAAGGGTAGTAAATCCTAATAGTAATATACAAGGTGTGGTTAGTGTAAATTATGC
TAATTACACTGGTACAACTTGGTTTTCTGATATAGTATATAATGGGGCTATTAAACCTATTACGGATCAG
TTTAGAACTTTTAGTAAAAATTTTTATATTAAGTTAATTAAAAATTCTGCAGTACAGAATATAGCTAAAG
GTTCATTAACTCTTTATGTGATTATATTTGGTCTCATGTTTGTTGCAGGAACATTAAAATTAACTGCTAT
AGAAGTAATAACACGTATATGTAAAATAGCTATAGTCGCTTTTTTAATCCGAGAAGAAAGTTGGAGTTTC
TTTAATACGTACTTCTTTAGTGTATTTACTGATGGTATTGATTTCTTTATAACTAACGTAGTAGGTGCTA
CAAGTTCTAGATCTAATATTTTTGGTTTTATTGATCCTATATTTGATAAATATACTAACGGTAGAATTTG
GGGATTACTGTTTATTGAATTATTACAAATACATAATGGTTTAGCATTTATCGCTATTATAACAATTTAT
TCACTTATTACTTATTTTCGAGCTATTTTAGAAGTGATAATAGGTTATATTATTGCATTCATAGGTGTAA
CAGTTATGATTTCATTAGCACCATTTTTTATAATATTAATGTTATTTGAAAAAACTAAAAGTTTATTTGA
TAATTGGATATCAACATTGTTGAGTTATGTGGTGCAACCAACAATATTATTAATTTTCTTTTTATTGATA
GATCAGGTTTTATCGGAGCAACTTTTAAAAGTGGTAGTTAGAGCTTGTTGGGATACTCTTATACCGATAA
AAATAGGGCTTGATTTAACAAATCTTAGTATTCCTATCAATTTCTCTTTTACATTACCGTTTTTACCAGG
CATACCTTTTTATGTACCTGATGTTCCAGAAATTAATAGATCGAATATTTTTAATAACAATACTAATACT
TTCTTAGTATTGTTTACTACGGCTTTATTATTTTATGTATATTGCTTGATGTCATATGGCTTAGTAACCT
TTGTTAATATAGTAGTTGGTATGCTTACAAATGTTACACCAGCACGAATATCAGGAAATTATCAAGCGCG
TTCTGATCCTGTAGGGGCCGTGATGCAAGATATAGGTTCGGTAACAACACCGATTAAAAATGCTTCAATG
GTCCCAGCTAGAATATTTAAAGACAAGATAATTGATCAAAATTATAAAGCTAAAAAATTGGAAGGAGGTG
TTGAATTTACAAATAAATTCTTTGCCAAGCGTAATGATGTAACGAAGAAAGAGGAAGGAGTGAGGGAATA
A
 Primer design

Protein ID: 51473243
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0030
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]36090..39005 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX4
KEGG IDrty:RT0030
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.8e-31, Aligned region: 615..854
Protein Sequence: 971 a.a.     [Download]
>gi|51473243|ref|YP_067000.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVRIGNGCYMRYSKDGNGGADSITNTITLNANANYFNISK
MLPDGTTKLIPDPNRYGEWLNTQVLVEKNQQVNLQVVGQVSLCLAYLPKNNLQFTERTRPGKSNLDDSNQ
MIPIPRVQDANSPPVSLIMDAKNNEWRNIAELYANDKVLVSVSPNFANTDATVDDVFKGVKVTKDCTQGK
TSYYPICGKYSIYSGKYVTACELKQNYWKGNVHREECYCVFGCIYQEENEQWICDAANSASHCCTSLVCD
SLPAWINHYSNMPEAYKDDGSFTFSWSDKSGNLLIDYQDLQCSNNVQIPPNGECPDIVDNRNPKDKDYIG
GVHCTSGICKDGDFQKNRKFWYTADGKGGKGPTGLIYQMNNTGSVSQALPSNLEFAKFVPETEQPPEYKD
KNGKYLYKVIYNIPFNSNIEKSYLQYRLWSPTSQDSSKNTGGYVLNIKQTKCYRENGNSFKDIFDDRGRV
QYIIVQSSENPNTSGKTYAPQGINVDSDGKSHFNANEAGYIWMKILNDPSNNLKDYKDSEGSYKVHFSTS
LKVGSFTIKVMNPLLQLFKTKVQGAATSIFKNMVCYKSTDNTSCTNFFTYIKAILILYVMTYGAMFLLGF
AKINQKELVIRIAKIGMVSGLINGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDA
IMSKIFFSQTFIAQLLSLLSLGLSGIIYFIITFIAVCIVIITTLRAIAVYIMAFMATCILIGIAPLFISF
LLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIYLDFVLGYSVCWKCTLPIKIPFIGTILPIA
LLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGRMVAKLTSAAGPSATQIGDRM
SHDAGQKTLSQIGMDYRTRKGITSRAKSRLKQRNRTLEHAEQNSKKYMKKIGENTNEGTLK
 
Nucleotide Sequence: 2916 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c39005-36090 Rickettsia typhi str. Wilmington, complete genome
ATGCAGAGTAACTTATTAAAAGTTTTAGGAGTACTCGCTATAGTAGCAACATTAGTTTGCTTTATTTTTG
CAGCACTTGGTATGATAGGAGCAGTAAGAATCGGTAACGGCTGTTACATGAGATATTCTAAAGACGGCAA
TGGAGGTGCGGATTCAATAACCAATACTATAACCCTTAATGCTAATGCTAATTATTTCAATATTTCTAAG
ATGTTGCCTGATGGCACTACTAAGCTTATACCAGATCCTAATCGTTACGGTGAATGGTTAAATACTCAGG
TACTAGTAGAAAAAAATCAACAGGTAAATTTACAAGTGGTCGGTCAAGTTAGTTTATGTTTGGCTTATTT
ACCAAAAAATAATTTACAATTTACTGAACGTACAAGACCTGGTAAATCGAATCTAGACGATAGCAATCAG
ATGATTCCAATTCCACGTGTTCAAGATGCAAATAGCCCACCCGTTTCTCTAATAATGGATGCAAAAAATA
ATGAATGGCGTAATATTGCTGAATTATACGCTAATGATAAAGTTTTAGTTTCTGTATCTCCTAATTTTGC
TAATACTGATGCAACAGTTGATGACGTTTTTAAAGGTGTGAAGGTTACAAAAGATTGTACACAAGGAAAA
ACTTCTTACTATCCGATTTGTGGGAAATATTCTATTTATTCCGGTAAATATGTTACTGCTTGTGAACTGA
AGCAAAATTATTGGAAAGGTAATGTGCATCGTGAAGAATGTTATTGTGTTTTTGGATGTATTTATCAAGA
AGAAAATGAACAGTGGATATGCGATGCTGCTAATTCTGCTTCTCATTGTTGTACTAGTTTAGTTTGTGAC
TCCTTACCTGCTTGGATCAATCACTATAGTAATATGCCGGAAGCTTATAAAGATGATGGCAGTTTTACAT
TTAGTTGGTCAGATAAGAGCGGTAATTTATTAATCGATTATCAGGATCTTCAATGTTCTAATAATGTTCA
GATCCCTCCAAACGGTGAATGTCCTGATATTGTTGATAATCGTAATCCTAAAGATAAAGATTATATAGGA
GGGGTACATTGTACCTCAGGAATATGTAAAGACGGAGATTTTCAAAAAAATCGGAAATTTTGGTATACAG
CAGATGGTAAAGGCGGAAAAGGTCCAACCGGATTGATATATCAAATGAATAATACTGGTTCTGTAAGTCA
AGCTCTACCTTCTAATCTAGAATTTGCTAAGTTTGTTCCAGAGACAGAACAACCACCTGAATATAAAGAT
AAAAACGGTAAATATTTATATAAAGTTATATATAATATACCTTTTAACAGTAATATTGAAAAAAGTTATT
TACAATATAGGCTTTGGTCGCCTACATCACAAGATTCTAGTAAGAATACGGGAGGATATGTTTTAAATAT
TAAACAGACTAAGTGTTATAGAGAGAATGGTAATAGTTTTAAAGATATTTTTGATGATCGTGGACGAGTA
CAATACATAATAGTACAGTCTTCAGAAAATCCGAATACTAGCGGTAAAACTTATGCACCTCAAGGAATTA
ATGTTGATAGTGATGGTAAATCTCACTTTAACGCGAATGAGGCTGGTTACATATGGATGAAAATCTTAAA
TGATCCTAGTAATAATTTAAAGGACTATAAAGATAGTGAAGGGAGCTATAAAGTGCATTTCTCAACATCA
TTAAAAGTAGGCAGTTTTACTATTAAAGTAATGAATCCATTACTTCAGTTATTTAAAACTAAAGTTCAAG
GTGCAGCTACTTCTATTTTCAAAAATATGGTATGTTATAAATCTACTGATAATACATCCTGTACTAACTT
TTTTACCTATATTAAAGCAATTTTAATCCTATATGTGATGACTTACGGAGCAATGTTCTTGCTTGGTTTT
GCTAAGATCAATCAAAAAGAGCTAGTAATTAGAATAGCAAAAATTGGAATGGTTAGCGGACTTATAAATG
GTAATACTTTTGAATTTTTCAATAACTATCTTTTTGATGCAATTACTAATTTTTCAGACTCAATTATTGC
TAATATGAGTGGATATAGTTTATTTACTTCTACTAATACTATTTCCAATCCTTTTATGTTTTTAGATGCA
ATAATGAGTAAAATATTTTTTAGTCAAACCTTTATTGCGCAATTACTTTCACTTCTTTCCCTTGGACTTA
GCGGTATTATATATTTTATAATTACTTTTATTGCTGTTTGTATAGTCATTATTACGACACTTAGAGCTAT
TGCCGTTTATATTATGGCATTTATGGCGACTTGCATATTAATCGGTATAGCACCTTTATTTATTAGTTTT
TTATTATTTGATTTTACTAGATATTTATTTGATAATTGGGTAAGATTTACGATCCGCTATATGATAGAAC
CGGTAGTTATGATGGCAGGTATTATCGTATTAACTCAACTATTTACAATTTATCTAGATTTTGTTTTAGG
TTATAGCGTTTGTTGGAAATGTACTTTACCGATCAAAATTCCATTTATTGGCACTATTTTGCCTATTGCA
TTGCTAAATGTACCTATCTTCTGTATTAATTGGTTTGCACCTTGGGGAATGGACTATATGTCAGGTATGA
TGGGAGTAAATATGCAAAATATTGTAGCTTTAGTTATTATTGCTTATGGTATGTATGGTTATGTCGAATT
TTCAGGTCGAATGGTAGCAAAATTAACTAGTGCTGCAGGACCTTCTGCTACTCAAATTGGTGATAGAATG
TCTCATGATGCTGGACAAAAAACATTAAGTCAAATAGGAATGGATTATAGAACAAGAAAAGGTATTACCA
GCAGAGCAAAATCAAGATTAAAACAACGCAATAGGACATTAGAACATGCTGAGCAAAATAGCAAAAAATA
CATGAAAAAAATTGGTGAGAATACAAATGAAGGAACACTAAAATAA
 Primer design

Protein ID: 51473244
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0031
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]39009..41033 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX3
KEGG IDrty:RT0031
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-14, Aligned region: 405..495
Protein Sequence: 674 a.a.     [Download]
>gi|51473244|ref|YP_067001.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKTLKALKIFIIVYISSVSLESFAGFGESCSNLPITSDGYLETYTAYGYIIRSIDMKDPRGNCNPYTSSI
TFCFKNVEGSTSPCTIYTLNEGDARKISDLSTDNNPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMP
VACKSLNATPAPTNPKYENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQDQNSRI
THLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFVVYFSIGLEPLNFSGGQ
TVKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRIGYYLGLDLLY
NIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDRPHDLSKAGALRFFTVMFGFLMSGHIIILVAGIAFSV
IFLSILLYFITHYLVCMITIYVMTYISPIFIPMVLFTRTKAYFDGWVKVCISCALQPAVVAGFIALLITM
YDSAIFKNCEFLRYDYEKGDIRFSTFELRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVR
DVVSILAELLCVLVFSVIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDASSVHAQG
KSPVEDKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL
 
Nucleotide Sequence: 2025 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c41033-39009 Rickettsia typhi str. Wilmington, complete genome
ATGAAAACTCTTAAAGCTTTAAAGATATTTATTATAGTTTATATATCGTCTGTAAGCTTAGAAAGCTTTG
CTGGATTTGGAGAATCATGCTCTAATTTACCGATTACTTCAGATGGGTATTTAGAAACATACACGGCATA
TGGGTATATAATTCGTAGTATTGATATGAAAGATCCGAGAGGTAATTGTAACCCATATACGTCTAGTATA
ACGTTTTGTTTTAAAAATGTAGAAGGTAGCACTAGTCCTTGTACCATATATACTTTAAATGAAGGTGATG
CTAGGAAGATTAGTGATTTAAGTACTGATAATAATCCTAATCTTGGTGCAAATACTGTATTAAAGAATAT
CGTTTTAACAGTTAAAAAATTTGGTAATGATCTATGTTTAGCTATGCCTACATCAAGGGGACCTATGCCA
GTAGCATGTAAATCTTTGAATGCTACTCCTGCTCCCACTAATCCTAAGTATGAGAATTGTAATATAGGCA
AAAGCTGTTATACAGGAGCAAATTATAGTCAATCATTAATTAATTTTTCTGGTCTTGCAGTTCAGTGTTT
AAGTGAAACCCTTAATAAAATATTTTTTACAGGAAATAGTTGTAGTTCTCAAGATCAAAATTCTAGAATA
ACTCATCTTGCCGCTTTTTCTACATTTCAAGGTTATTTAAAGAGAATTATAGGTGCGGCATTAATTCTTT
ATACTATGTTTTTTGCCTTTAATATGGCTCTTAATAAGGAATATGCAACTACTGAAAAAATAACTCTTTT
TATAATAAAATTCTTATTTGTTGTATATTTTTCGATCGGTCTTGAACCTTTAAATTTTAGTGGTGGTCAG
ACAGTAAAAGAAAACGGTATGTTAAAATATGGACTGCCTCTTTTGACTGGGGCAGCACCTGATTTTGCAG
AAATGATCTTTAATGCGGCAGGTTCTAGAGGGTTATGTCAGTTTGATAATTCAAAGTATAAGGACGGTTA
TAAATTTTATGGTTTATGGGATGCGATTGATTGCCGTATAGGTTATTATCTTGGTTTGGATTTACTTTAT
AATATTGATAAAAATGGAATTTTAGGGCATTCAGTCGGTAATGGTCCTGGCGGTAATAATAAACCTATAC
CTAATTTTGATCCTGATAGCAAAAAAGATAGACCACACGATTTAAGTAAAGCAGGAGCACTGAGATTTTT
TACTGTTATGTTTGGATTTTTGATGTCTGGACACATTATTATACTTGTGGCAGGTATAGCATTTTCTGTA
ATATTTTTATCTATACTTTTGTATTTTATTACACATTATTTAGTTTGTATGATTACCATTTACGTTATGA
CATATATTTCGCCTATATTCATTCCTATGGTTTTATTTACTCGTACAAAAGCTTATTTTGACGGGTGGGT
AAAAGTATGTATTTCATGTGCATTACAACCTGCAGTAGTAGCAGGTTTTATAGCTCTATTAATAACTATG
TATGATTCTGCAATATTTAAAAATTGTGAATTCTTAAGATATGATTATGAAAAAGGTGATATTAGATTTA
GTACTTTTGAGTTAAGGCTCCCTAGCATTGATGCAGATAAATGTCAAGAAAGCTTTGGGTATAAAATGTT
AAAATATTATGCAGGTGAAGGTTGGGAAGAACATTTATTGATACTCTTTCCAATAAAATCAATTGTTCGA
GATGTTGTATCTATTTTAGCAGAACTTTTGTGTGTATTAGTATTTTCGGTTATTTTTTATTACTTCTCTA
AATCTATAGGACGCTTTGCTGCTGATTTAACTAATGGTCCTAATATGGATGCAGTAACGGCGAGTCCAAC
TAAAATTGTTGATTTAGTAAAAAAAGGAGCAGCATTCCTGCAGGATGCTTCTTCAGTACATGCACAAGGT
AAGTCACCTGTGGAAGATAAGCCAGATATTGGTAGTAAGCGTAAAGATGGAGTGCAACAAGGTGAAGATT
CTGAAAACAGTTCTGGAGGAGAGTTAGCTGATTTAGCAAGCGGTTCTGGTGGAGGCAAATTATAG
 Primer design

Protein ID: 51473245
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0032
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]41020..44427 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX2
KEGG IDrty:RT0032
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.4e-11, Aligned region: 505..580
Protein Sequence: 1135 a.a.     [Download]
>gi|51473245|ref|YP_067002.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MALFPRGILIALVLSFVLNLGLVTKIHAKDTLDSIIDILSGLTCETQGVGDLMRTEFSHTCIVAPFFTFA
VMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFPGGQCTRENRIDPKNPELHFALCSNAKLIVSRAKSVT
ESALAIAKAVLTWSDPWDDIKQAWENKKKEYHIPYRGKPGDDGFAFDVGFPVIYWKVIQDRDRICVSTKG
FTGDVPVGCKYMKEPFPKSIYNSFIDVEDKNFIKDSTNDTPSDPLALVSCSAAGDGCYQKAYNASKTAIV
MTSPLIECIRQMIARLLISKDVCSFDNVDQVVNLASRQDSALFQFQVGMHKIVTAFLTLYVMFFGFKLLL
AGKVPPKSEYINFILKIIFVTYFSIGININPSNGSQYDRLDGMIQWVFPFLLNGISGLANWVMNAAPSGL
CKFNNISYDKSVSYIALWDALDCRVAHYLGLDILSTLLVENSYRSHDFLNFDFFSFSAPPYIYLIIPAII
SGNMMLVSLALSYPLLVISVAAFMVNATIMCMISIVILGILAPLFVPMFLFAYTRNYFDSWVKLMISFLL
QPMVVVTFMITMFAVYDYGFYGKCQYKSKLIHNSIEDKMQGGIKSKRDVLIFYINNDWDDTSQYPDKDSV
ESCKNSLGYMLNNPINTAFNFAKDNISEIVNSKPGETTTDEFLSKFQFLSGVVLGPGMFFMSPKVLFEKI
KNIFLALITACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMAALANAGTATKGIDQIAS
RGGGGGARDLIGAKGLVSDNIASSGGAVGDNIASSGGAVGDNIAVSGAASTPTVTTTTASSSIANSMTKT
IGDDVRSDIVTPHASTTAVPQHSSINTTIPTSVSPNIKSTSLKEIIRDNQENEKEIDNTTRAQEKIKSSS
KVSGLIDYSFNLKEHDNPTGIKQIRENAEIRDKRVEVEKAWNELVASGGGRIRDQQSEETSEQRTNAEKK
WNEFVDSGVVTEIREIDNSVNNKLADKLDKSEKSKIEENKNIENNIKVYNTNTLPQEKVNNTDKSSGLID
YSFNLKEHDNPTGVKQIRENAEIRDKRVKVEKAWNELVASGGGRVKEQAGGKITERRANAEKVWDDLVKS
GVVKEKKDNSSNENS
 
Nucleotide Sequence: 3408 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c44427-41020 Rickettsia typhi str. Wilmington, complete genome
ATGGCATTATTCCCTCGTGGTATACTGATAGCATTAGTACTGAGCTTTGTCCTAAATTTAGGTCTAGTGA
CTAAAATTCATGCTAAAGATACTCTTGATAGCATTATAGATATTTTGAGTGGCTTAACTTGCGAAACACA
AGGTGTAGGTGATTTAATGCGTACTGAATTTTCACATACATGTATTGTCGCTCCGTTTTTTACTTTTGCG
GTAATGAATCTTGTATCTCCCGTTTTATACATGAATACATTTTTAAAGCTTAAAATAAATGACAGTGATT
TATTTAACGATAGTAATTTTGGGAATTTTCCCGGAGGTCAATGTACTCGTGAAAACAGAATTGATCCTAA
AAATCCAGAATTACATTTTGCTCTATGTAGTAATGCTAAATTAATTGTATCGCGTGCAAAATCAGTTACA
GAATCGGCACTTGCTATTGCTAAAGCCGTCTTAACATGGAGTGATCCTTGGGATGATATAAAGCAAGCGT
GGGAAAATAAAAAAAAGGAATATCATATTCCATATAGAGGTAAGCCTGGTGATGACGGTTTTGCATTTGA
TGTAGGCTTCCCTGTAATATATTGGAAAGTTATTCAAGATAGAGATAGAATATGTGTCTCAACAAAAGGG
TTTACAGGAGATGTGCCAGTCGGCTGTAAATATATGAAAGAGCCGTTTCCAAAATCCATATATAATAGTT
TTATTGATGTAGAAGATAAGAATTTTATTAAAGATTCAACAAATGACACACCTAGCGATCCTTTAGCTTT
AGTTTCCTGTAGTGCTGCAGGAGATGGGTGTTATCAAAAAGCTTATAATGCTTCAAAAACTGCAATAGTC
ATGACTTCTCCTCTTATAGAATGTATAAGGCAAATGATTGCTAGATTACTAATTAGTAAAGATGTTTGTA
GTTTTGATAATGTAGATCAAGTTGTGAATTTGGCATCAAGACAAGATAGTGCATTATTTCAGTTCCAAGT
AGGCATGCATAAAATAGTTACGGCTTTTTTAACTTTATATGTTATGTTTTTTGGTTTTAAGTTATTACTT
GCAGGTAAAGTGCCGCCAAAAAGTGAGTATATAAATTTTATATTGAAAATAATATTTGTAACTTATTTTT
CAATAGGAATTAATATAAATCCTTCTAATGGTTCTCAGTATGATCGGTTAGATGGAATGATTCAGTGGGT
GTTTCCTTTCTTACTTAACGGTATAAGCGGTTTAGCAAATTGGGTTATGAATGCTGCTCCGTCTGGTTTA
TGTAAATTTAATAATATTTCTTATGATAAAAGTGTTTCATATATTGCATTATGGGATGCATTAGATTGTA
GAGTTGCTCATTATTTAGGACTTGATATATTATCTACTTTACTTGTAGAAAATTCGTATCGAAGCCATGA
TTTTTTAAATTTTGATTTCTTTAGTTTTAGTGCCCCACCATATATTTATTTAATAATTCCAGCAATAATC
TCTGGTAATATGATGTTGGTATCACTTGCACTTTCTTACCCGTTACTGGTGATTTCTGTCGCTGCATTTA
TGGTTAATGCAACAATTATGTGTATGATATCTATAGTCATACTCGGTATTCTAGCTCCTCTTTTCGTGCC
TATGTTCTTATTTGCGTATACACGAAATTATTTTGATAGCTGGGTTAAGCTGATGATTTCATTCTTGCTA
CAGCCTATGGTAGTAGTCACGTTTATGATTACGATGTTTGCAGTATATGATTATGGCTTTTATGGTAAAT
GTCAATATAAGAGCAAGTTAATTCATAATAGCATAGAAGATAAAATGCAAGGTGGTATAAAATCTAAGAG
AGATGTTTTAATATTTTATATTAATAATGATTGGGATGACACATCACAATATCCTGATAAAGATTCAGTA
GAGAGTTGTAAAAATAGTTTAGGGTATATGTTAAATAACCCTATTAATACAGCATTTAACTTTGCAAAAG
ATAATATCAGTGAAATAGTTAATAGTAAACCTGGTGAGACCACTACTGATGAATTTCTTTCTAAATTTCA
GTTTTTATCAGGAGTTGTTTTGGGTCCTGGTATGTTTTTTATGTCGCCAAAAGTGCTTTTTGAGAAAATT
AAAAATATTTTTCTTGCATTAATTACTGCATGTTTTACATTGTATTTAATGTATAATTTTAGTAGTCAAC
TAGCTGAATTTGCTGCAGATATGACAGAAGGAGTTGCGCTTAATAATGTTGCTATCAAGCCACAAGCAAT
ATTTAAGGCAGCTATGGCAGCGCTTGCTAATGCTGGTACTGCAACTAAGGGTATAGATCAGATAGCAAGC
CGTGGAGGAGGTGGAGGTGCACGTGATTTAATTGGAGCTAAAGGATTGGTAAGTGATAATATAGCTTCAA
GTGGAGGTGCTGTCGGTGATAATATAGCTTCAAGTGGAGGTGCTGTCGGTGATAATATTGCTGTGAGTGG
AGCTGCGTCAACACCTACAGTAACAACAACTACAGCTTCGTCTTCAATAGCAAATTCTATGACAAAAACT
ATAGGTGATGATGTAAGATCAGATATTGTCACTCCTCATGCTTCTACAACAGCTGTTCCACAGCATTCTA
GCATTAATACTACTATTCCTACATCTGTATCACCTAATATTAAATCTACAAGTCTTAAGGAAATTATTAG
AGATAATCAAGAAAATGAAAAAGAGATCGATAATACTACGCGTGCACAAGAAAAAATTAAAAGTTCAAGT
AAAGTTTCAGGACTAATTGATTATAGTTTTAACTTAAAGGAACATGATAATCCAACAGGAATAAAACAGA
TAAGGGAAAATGCAGAGATTCGTGATAAACGTGTAGAAGTAGAGAAAGCATGGAACGAATTAGTGGCAAG
TGGTGGAGGCAGAATAAGAGATCAACAAAGTGAAGAAACATCGGAGCAACGTACTAATGCAGAAAAGAAA
TGGAATGAATTTGTTGATAGCGGTGTAGTAACTGAAATAAGAGAAATTGATAATAGTGTCAATAATAAAT
TAGCTGATAAACTTGATAAATCAGAAAAATCAAAGATAGAAGAAAATAAAAATATAGAAAATAACATTAA
AGTCTATAATACTAATACGTTGCCACAAGAAAAAGTCAATAATACAGATAAAAGTTCAGGACTAATTGAT
TATAGTTTTAACTTAAAAGAACATGATAATCCAACAGGAGTAAAACAGATAAGGGAAAATGCAGAAATTC
GTGATAAACGTGTAAAAGTAGAAAAAGCATGGAATGAACTAGTCGCAAGTGGAGGTGGAAGAGTAAAAGA
ACAAGCAGGAGGAAAAATAACAGAACGACGTGCAAATGCAGAAAAGGTATGGGATGATTTAGTTAAAAGT
GGTGTAGTAAAAGAAAAAAAAGATAATAGTTCTAATGAAAACTCTTAA
 Primer design