SecReT4
Protein ID: 51473242
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0029
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]33268..35928 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX5
KEGG IDrty:RT0029
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-20, Aligned region: 516..710
Protein Sequence: 886 a.a.     [Download]
>gi|51473242|ref|YP_066999.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKILKSLVLLVLFIVMPAKAHDTFSWMSTSFSGLKGLFGCLEVPEFTSFQESNIGINLSKAGTWQSTGHT
VEKGKLLKINWSIAGVTTEPRKYLVLYRIDPRFSTPQVFIKTYNYSKLQFEALGFPRFVTNSNSSIPGAI
PPDKELDALSFTKMSDSIKYYARNNVKIEVKAGDVVNISLVSKDNFFTSNTLDNILTEELDSSIFAASAL
YTQSNLGNFDNRIIYASAKEVCDIIDPSRDPNKPSGCSGTGATTKYKSINSNEALVGKPMMIGAVHNFMG
LINSCPEHSGINTRPACYYDQGRGMIIKVGGQVIKGRDQSFVKSGRNSFIYYQATRNGIMDFTSDWQVNN
MFSNSVLMSDWIRRFLNYPSFIDYINKNDWSANFLYFGRYSMIVEIGNGANSISSDVQQNINLEYLITYD
GTLPDPSIRGTPVDYNFSADAPKDGYLWLRVVNPNSNIQGVVSVNYANYTGTTWFSDIVYNGAIKPITDQ
FRTFSKNFYIKLIKNSAVQNIAKGSLTLYVIIFGLMFVAGTLKLTAIEVITRICKIAIVAFLIREESWSF
FNTYFFSVFTDGIDFFITNVVGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIY
SLITYFRAILEVIIGYIIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQPTILLIFFLLI
DQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLSIPINFSFTLPFLPGIPFYVPDVPEINRSNIFNNNTNT
FLVLFTTALLFYVYCLMSYGLVTFVNIVVGMLTNVTPARISGNYQARSDPVGAVMQDIGSVTTPIKNASM
VPARIFKDKIIDQNYKAKKLEGGVEFTNKFFAKRNDVTKKEEGVRE
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c35928-33268 Rickettsia typhi str. Wilmington, complete genome
ATGAAAATTCTTAAGAGTTTAGTTTTATTAGTTTTGTTTATTGTAATGCCAGCTAAAGCTCATGATACTT
TTTCATGGATGTCAACTAGTTTTAGTGGATTAAAAGGCTTATTCGGTTGTTTAGAAGTACCTGAATTTAC
AAGTTTTCAAGAAAGTAATATAGGAATTAATTTATCTAAAGCAGGGACTTGGCAATCAACAGGTCATACT
GTTGAGAAAGGTAAATTGTTAAAAATAAATTGGTCTATTGCAGGTGTTACTACTGAACCTAGAAAATATC
TAGTATTATATAGAATTGATCCAAGATTTAGTACACCTCAAGTTTTTATTAAAACTTATAATTATTCGAA
ATTACAATTTGAAGCTTTAGGATTCCCTCGTTTTGTTACGAACAGTAACAGTTCAATACCTGGAGCTATA
CCACCCGATAAAGAGCTTGATGCACTTTCATTTACTAAAATGTCTGATTCTATAAAATATTATGCTAGAA
ATAATGTAAAAATTGAAGTTAAGGCTGGTGATGTAGTAAATATTAGTTTAGTTAGTAAAGATAATTTTTT
TACTTCTAATACTCTAGATAATATTTTAACAGAAGAACTTGATAGTTCAATATTTGCTGCTTCTGCACTT
TATACTCAAAGTAACCTTGGAAATTTTGATAATAGAATAATTTATGCATCTGCAAAAGAGGTATGTGATA
TTATAGATCCTTCAAGAGATCCTAATAAACCAAGTGGATGTAGCGGTACTGGTGCAACTACAAAATATAA
AAGTATAAATAGTAATGAAGCATTAGTTGGCAAACCTATGATGATTGGGGCGGTACATAATTTCATGGGA
TTAATTAATTCTTGCCCTGAGCACTCCGGTATAAATACTAGACCTGCTTGCTATTATGATCAAGGTAGAG
GGATGATAATTAAAGTAGGGGGACAGGTTATTAAGGGACGAGATCAGAGTTTTGTAAAATCAGGCAGAAA
TAGCTTTATATATTATCAAGCGACTAGGAATGGTATTATGGATTTTACTAGTGATTGGCAAGTTAATAAT
ATGTTTAGTAATTCAGTTTTAATGAGTGATTGGATTAGACGTTTTTTAAATTATCCTAGTTTTATAGATT
ATATCAATAAGAATGATTGGTCAGCTAATTTTTTATATTTTGGTCGTTATTCGATGATTGTTGAAATAGG
TAATGGGGCTAATTCAATTAGTTCTGATGTCCAACAAAATATAAATTTAGAATATTTAATAACATATGAT
GGTACATTACCTGATCCATCTATTCGTGGTACACCGGTAGATTATAATTTTTCAGCTGATGCACCGAAAG
ATGGCTATTTATGGTTAAGGGTAGTAAATCCTAATAGTAATATACAAGGTGTGGTTAGTGTAAATTATGC
TAATTACACTGGTACAACTTGGTTTTCTGATATAGTATATAATGGGGCTATTAAACCTATTACGGATCAG
TTTAGAACTTTTAGTAAAAATTTTTATATTAAGTTAATTAAAAATTCTGCAGTACAGAATATAGCTAAAG
GTTCATTAACTCTTTATGTGATTATATTTGGTCTCATGTTTGTTGCAGGAACATTAAAATTAACTGCTAT
AGAAGTAATAACACGTATATGTAAAATAGCTATAGTCGCTTTTTTAATCCGAGAAGAAAGTTGGAGTTTC
TTTAATACGTACTTCTTTAGTGTATTTACTGATGGTATTGATTTCTTTATAACTAACGTAGTAGGTGCTA
CAAGTTCTAGATCTAATATTTTTGGTTTTATTGATCCTATATTTGATAAATATACTAACGGTAGAATTTG
GGGATTACTGTTTATTGAATTATTACAAATACATAATGGTTTAGCATTTATCGCTATTATAACAATTTAT
TCACTTATTACTTATTTTCGAGCTATTTTAGAAGTGATAATAGGTTATATTATTGCATTCATAGGTGTAA
CAGTTATGATTTCATTAGCACCATTTTTTATAATATTAATGTTATTTGAAAAAACTAAAAGTTTATTTGA
TAATTGGATATCAACATTGTTGAGTTATGTGGTGCAACCAACAATATTATTAATTTTCTTTTTATTGATA
GATCAGGTTTTATCGGAGCAACTTTTAAAAGTGGTAGTTAGAGCTTGTTGGGATACTCTTATACCGATAA
AAATAGGGCTTGATTTAACAAATCTTAGTATTCCTATCAATTTCTCTTTTACATTACCGTTTTTACCAGG
CATACCTTTTTATGTACCTGATGTTCCAGAAATTAATAGATCGAATATTTTTAATAACAATACTAATACT
TTCTTAGTATTGTTTACTACGGCTTTATTATTTTATGTATATTGCTTGATGTCATATGGCTTAGTAACCT
TTGTTAATATAGTAGTTGGTATGCTTACAAATGTTACACCAGCACGAATATCAGGAAATTATCAAGCGCG
TTCTGATCCTGTAGGGGCCGTGATGCAAGATATAGGTTCGGTAACAACACCGATTAAAAATGCTTCAATG
GTCCCAGCTAGAATATTTAAAGACAAGATAATTGATCAAAATTATAAAGCTAAAAAATTGGAAGGAGGTG
TTGAATTTACAAATAAATTCTTTGCCAAGCGTAATGATGTAACGAAGAAAGAGGAAGGAGTGAGGGAATA
A
 Primer design