SecReT4
Protein ID: 51473243
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0030
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]36090..39005 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX4
KEGG IDrty:RT0030
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.8e-31, Aligned region: 615..854
Protein Sequence: 971 a.a.     [Download]
>gi|51473243|ref|YP_067000.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVRIGNGCYMRYSKDGNGGADSITNTITLNANANYFNISK
MLPDGTTKLIPDPNRYGEWLNTQVLVEKNQQVNLQVVGQVSLCLAYLPKNNLQFTERTRPGKSNLDDSNQ
MIPIPRVQDANSPPVSLIMDAKNNEWRNIAELYANDKVLVSVSPNFANTDATVDDVFKGVKVTKDCTQGK
TSYYPICGKYSIYSGKYVTACELKQNYWKGNVHREECYCVFGCIYQEENEQWICDAANSASHCCTSLVCD
SLPAWINHYSNMPEAYKDDGSFTFSWSDKSGNLLIDYQDLQCSNNVQIPPNGECPDIVDNRNPKDKDYIG
GVHCTSGICKDGDFQKNRKFWYTADGKGGKGPTGLIYQMNNTGSVSQALPSNLEFAKFVPETEQPPEYKD
KNGKYLYKVIYNIPFNSNIEKSYLQYRLWSPTSQDSSKNTGGYVLNIKQTKCYRENGNSFKDIFDDRGRV
QYIIVQSSENPNTSGKTYAPQGINVDSDGKSHFNANEAGYIWMKILNDPSNNLKDYKDSEGSYKVHFSTS
LKVGSFTIKVMNPLLQLFKTKVQGAATSIFKNMVCYKSTDNTSCTNFFTYIKAILILYVMTYGAMFLLGF
AKINQKELVIRIAKIGMVSGLINGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDA
IMSKIFFSQTFIAQLLSLLSLGLSGIIYFIITFIAVCIVIITTLRAIAVYIMAFMATCILIGIAPLFISF
LLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIYLDFVLGYSVCWKCTLPIKIPFIGTILPIA
LLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGRMVAKLTSAAGPSATQIGDRM
SHDAGQKTLSQIGMDYRTRKGITSRAKSRLKQRNRTLEHAEQNSKKYMKKIGENTNEGTLK
 
Nucleotide Sequence: 2916 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c39005-36090 Rickettsia typhi str. Wilmington, complete genome
ATGCAGAGTAACTTATTAAAAGTTTTAGGAGTACTCGCTATAGTAGCAACATTAGTTTGCTTTATTTTTG
CAGCACTTGGTATGATAGGAGCAGTAAGAATCGGTAACGGCTGTTACATGAGATATTCTAAAGACGGCAA
TGGAGGTGCGGATTCAATAACCAATACTATAACCCTTAATGCTAATGCTAATTATTTCAATATTTCTAAG
ATGTTGCCTGATGGCACTACTAAGCTTATACCAGATCCTAATCGTTACGGTGAATGGTTAAATACTCAGG
TACTAGTAGAAAAAAATCAACAGGTAAATTTACAAGTGGTCGGTCAAGTTAGTTTATGTTTGGCTTATTT
ACCAAAAAATAATTTACAATTTACTGAACGTACAAGACCTGGTAAATCGAATCTAGACGATAGCAATCAG
ATGATTCCAATTCCACGTGTTCAAGATGCAAATAGCCCACCCGTTTCTCTAATAATGGATGCAAAAAATA
ATGAATGGCGTAATATTGCTGAATTATACGCTAATGATAAAGTTTTAGTTTCTGTATCTCCTAATTTTGC
TAATACTGATGCAACAGTTGATGACGTTTTTAAAGGTGTGAAGGTTACAAAAGATTGTACACAAGGAAAA
ACTTCTTACTATCCGATTTGTGGGAAATATTCTATTTATTCCGGTAAATATGTTACTGCTTGTGAACTGA
AGCAAAATTATTGGAAAGGTAATGTGCATCGTGAAGAATGTTATTGTGTTTTTGGATGTATTTATCAAGA
AGAAAATGAACAGTGGATATGCGATGCTGCTAATTCTGCTTCTCATTGTTGTACTAGTTTAGTTTGTGAC
TCCTTACCTGCTTGGATCAATCACTATAGTAATATGCCGGAAGCTTATAAAGATGATGGCAGTTTTACAT
TTAGTTGGTCAGATAAGAGCGGTAATTTATTAATCGATTATCAGGATCTTCAATGTTCTAATAATGTTCA
GATCCCTCCAAACGGTGAATGTCCTGATATTGTTGATAATCGTAATCCTAAAGATAAAGATTATATAGGA
GGGGTACATTGTACCTCAGGAATATGTAAAGACGGAGATTTTCAAAAAAATCGGAAATTTTGGTATACAG
CAGATGGTAAAGGCGGAAAAGGTCCAACCGGATTGATATATCAAATGAATAATACTGGTTCTGTAAGTCA
AGCTCTACCTTCTAATCTAGAATTTGCTAAGTTTGTTCCAGAGACAGAACAACCACCTGAATATAAAGAT
AAAAACGGTAAATATTTATATAAAGTTATATATAATATACCTTTTAACAGTAATATTGAAAAAAGTTATT
TACAATATAGGCTTTGGTCGCCTACATCACAAGATTCTAGTAAGAATACGGGAGGATATGTTTTAAATAT
TAAACAGACTAAGTGTTATAGAGAGAATGGTAATAGTTTTAAAGATATTTTTGATGATCGTGGACGAGTA
CAATACATAATAGTACAGTCTTCAGAAAATCCGAATACTAGCGGTAAAACTTATGCACCTCAAGGAATTA
ATGTTGATAGTGATGGTAAATCTCACTTTAACGCGAATGAGGCTGGTTACATATGGATGAAAATCTTAAA
TGATCCTAGTAATAATTTAAAGGACTATAAAGATAGTGAAGGGAGCTATAAAGTGCATTTCTCAACATCA
TTAAAAGTAGGCAGTTTTACTATTAAAGTAATGAATCCATTACTTCAGTTATTTAAAACTAAAGTTCAAG
GTGCAGCTACTTCTATTTTCAAAAATATGGTATGTTATAAATCTACTGATAATACATCCTGTACTAACTT
TTTTACCTATATTAAAGCAATTTTAATCCTATATGTGATGACTTACGGAGCAATGTTCTTGCTTGGTTTT
GCTAAGATCAATCAAAAAGAGCTAGTAATTAGAATAGCAAAAATTGGAATGGTTAGCGGACTTATAAATG
GTAATACTTTTGAATTTTTCAATAACTATCTTTTTGATGCAATTACTAATTTTTCAGACTCAATTATTGC
TAATATGAGTGGATATAGTTTATTTACTTCTACTAATACTATTTCCAATCCTTTTATGTTTTTAGATGCA
ATAATGAGTAAAATATTTTTTAGTCAAACCTTTATTGCGCAATTACTTTCACTTCTTTCCCTTGGACTTA
GCGGTATTATATATTTTATAATTACTTTTATTGCTGTTTGTATAGTCATTATTACGACACTTAGAGCTAT
TGCCGTTTATATTATGGCATTTATGGCGACTTGCATATTAATCGGTATAGCACCTTTATTTATTAGTTTT
TTATTATTTGATTTTACTAGATATTTATTTGATAATTGGGTAAGATTTACGATCCGCTATATGATAGAAC
CGGTAGTTATGATGGCAGGTATTATCGTATTAACTCAACTATTTACAATTTATCTAGATTTTGTTTTAGG
TTATAGCGTTTGTTGGAAATGTACTTTACCGATCAAAATTCCATTTATTGGCACTATTTTGCCTATTGCA
TTGCTAAATGTACCTATCTTCTGTATTAATTGGTTTGCACCTTGGGGAATGGACTATATGTCAGGTATGA
TGGGAGTAAATATGCAAAATATTGTAGCTTTAGTTATTATTGCTTATGGTATGTATGGTTATGTCGAATT
TTCAGGTCGAATGGTAGCAAAATTAACTAGTGCTGCAGGACCTTCTGCTACTCAAATTGGTGATAGAATG
TCTCATGATGCTGGACAAAAAACATTAAGTCAAATAGGAATGGATTATAGAACAAGAAAAGGTATTACCA
GCAGAGCAAAATCAAGATTAAAACAACGCAATAGGACATTAGAACATGCTGAGCAAAATAGCAAAAAATA
CATGAAAAAAATTGGTGAGAATACAAATGAAGGAACACTAAAATAA
 Primer design