SecReT4
Protein ID: 51473244
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0031
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]39009..41033 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX3
KEGG IDrty:RT0031
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-14, Aligned region: 405..495
Protein Sequence: 674 a.a.     [Download]
>gi|51473244|ref|YP_067001.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MKTLKALKIFIIVYISSVSLESFAGFGESCSNLPITSDGYLETYTAYGYIIRSIDMKDPRGNCNPYTSSI
TFCFKNVEGSTSPCTIYTLNEGDARKISDLSTDNNPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMP
VACKSLNATPAPTNPKYENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQDQNSRI
THLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFVVYFSIGLEPLNFSGGQ
TVKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRIGYYLGLDLLY
NIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDRPHDLSKAGALRFFTVMFGFLMSGHIIILVAGIAFSV
IFLSILLYFITHYLVCMITIYVMTYISPIFIPMVLFTRTKAYFDGWVKVCISCALQPAVVAGFIALLITM
YDSAIFKNCEFLRYDYEKGDIRFSTFELRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVR
DVVSILAELLCVLVFSVIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDASSVHAQG
KSPVEDKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL
 
Nucleotide Sequence: 2025 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c41033-39009 Rickettsia typhi str. Wilmington, complete genome
ATGAAAACTCTTAAAGCTTTAAAGATATTTATTATAGTTTATATATCGTCTGTAAGCTTAGAAAGCTTTG
CTGGATTTGGAGAATCATGCTCTAATTTACCGATTACTTCAGATGGGTATTTAGAAACATACACGGCATA
TGGGTATATAATTCGTAGTATTGATATGAAAGATCCGAGAGGTAATTGTAACCCATATACGTCTAGTATA
ACGTTTTGTTTTAAAAATGTAGAAGGTAGCACTAGTCCTTGTACCATATATACTTTAAATGAAGGTGATG
CTAGGAAGATTAGTGATTTAAGTACTGATAATAATCCTAATCTTGGTGCAAATACTGTATTAAAGAATAT
CGTTTTAACAGTTAAAAAATTTGGTAATGATCTATGTTTAGCTATGCCTACATCAAGGGGACCTATGCCA
GTAGCATGTAAATCTTTGAATGCTACTCCTGCTCCCACTAATCCTAAGTATGAGAATTGTAATATAGGCA
AAAGCTGTTATACAGGAGCAAATTATAGTCAATCATTAATTAATTTTTCTGGTCTTGCAGTTCAGTGTTT
AAGTGAAACCCTTAATAAAATATTTTTTACAGGAAATAGTTGTAGTTCTCAAGATCAAAATTCTAGAATA
ACTCATCTTGCCGCTTTTTCTACATTTCAAGGTTATTTAAAGAGAATTATAGGTGCGGCATTAATTCTTT
ATACTATGTTTTTTGCCTTTAATATGGCTCTTAATAAGGAATATGCAACTACTGAAAAAATAACTCTTTT
TATAATAAAATTCTTATTTGTTGTATATTTTTCGATCGGTCTTGAACCTTTAAATTTTAGTGGTGGTCAG
ACAGTAAAAGAAAACGGTATGTTAAAATATGGACTGCCTCTTTTGACTGGGGCAGCACCTGATTTTGCAG
AAATGATCTTTAATGCGGCAGGTTCTAGAGGGTTATGTCAGTTTGATAATTCAAAGTATAAGGACGGTTA
TAAATTTTATGGTTTATGGGATGCGATTGATTGCCGTATAGGTTATTATCTTGGTTTGGATTTACTTTAT
AATATTGATAAAAATGGAATTTTAGGGCATTCAGTCGGTAATGGTCCTGGCGGTAATAATAAACCTATAC
CTAATTTTGATCCTGATAGCAAAAAAGATAGACCACACGATTTAAGTAAAGCAGGAGCACTGAGATTTTT
TACTGTTATGTTTGGATTTTTGATGTCTGGACACATTATTATACTTGTGGCAGGTATAGCATTTTCTGTA
ATATTTTTATCTATACTTTTGTATTTTATTACACATTATTTAGTTTGTATGATTACCATTTACGTTATGA
CATATATTTCGCCTATATTCATTCCTATGGTTTTATTTACTCGTACAAAAGCTTATTTTGACGGGTGGGT
AAAAGTATGTATTTCATGTGCATTACAACCTGCAGTAGTAGCAGGTTTTATAGCTCTATTAATAACTATG
TATGATTCTGCAATATTTAAAAATTGTGAATTCTTAAGATATGATTATGAAAAAGGTGATATTAGATTTA
GTACTTTTGAGTTAAGGCTCCCTAGCATTGATGCAGATAAATGTCAAGAAAGCTTTGGGTATAAAATGTT
AAAATATTATGCAGGTGAAGGTTGGGAAGAACATTTATTGATACTCTTTCCAATAAAATCAATTGTTCGA
GATGTTGTATCTATTTTAGCAGAACTTTTGTGTGTATTAGTATTTTCGGTTATTTTTTATTACTTCTCTA
AATCTATAGGACGCTTTGCTGCTGATTTAACTAATGGTCCTAATATGGATGCAGTAACGGCGAGTCCAAC
TAAAATTGTTGATTTAGTAAAAAAAGGAGCAGCATTCCTGCAGGATGCTTCTTCAGTACATGCACAAGGT
AAGTCACCTGTGGAAGATAAGCCAGATATTGGTAGTAAGCGTAAAGATGGAGTGCAACAAGGTGAAGATT
CTGAAAACAGTTCTGGAGGAGAGTTAGCTGATTTAGCAAGCGGTTCTGGTGGAGGCAAATTATAG
 Primer design