SecReT4
Protein ID: 51473245
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0032
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]41020..44427 [-]
ProductVirB6-like protein of the type IV secretion system
Component typeVirB6
UniProt IDQ68XX2
KEGG IDrty:RT0032
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.4e-11, Aligned region: 505..580
Protein Sequence: 1135 a.a.     [Download]
>gi|51473245|ref|YP_067002.1| VirB6-like protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MALFPRGILIALVLSFVLNLGLVTKIHAKDTLDSIIDILSGLTCETQGVGDLMRTEFSHTCIVAPFFTFA
VMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFPGGQCTRENRIDPKNPELHFALCSNAKLIVSRAKSVT
ESALAIAKAVLTWSDPWDDIKQAWENKKKEYHIPYRGKPGDDGFAFDVGFPVIYWKVIQDRDRICVSTKG
FTGDVPVGCKYMKEPFPKSIYNSFIDVEDKNFIKDSTNDTPSDPLALVSCSAAGDGCYQKAYNASKTAIV
MTSPLIECIRQMIARLLISKDVCSFDNVDQVVNLASRQDSALFQFQVGMHKIVTAFLTLYVMFFGFKLLL
AGKVPPKSEYINFILKIIFVTYFSIGININPSNGSQYDRLDGMIQWVFPFLLNGISGLANWVMNAAPSGL
CKFNNISYDKSVSYIALWDALDCRVAHYLGLDILSTLLVENSYRSHDFLNFDFFSFSAPPYIYLIIPAII
SGNMMLVSLALSYPLLVISVAAFMVNATIMCMISIVILGILAPLFVPMFLFAYTRNYFDSWVKLMISFLL
QPMVVVTFMITMFAVYDYGFYGKCQYKSKLIHNSIEDKMQGGIKSKRDVLIFYINNDWDDTSQYPDKDSV
ESCKNSLGYMLNNPINTAFNFAKDNISEIVNSKPGETTTDEFLSKFQFLSGVVLGPGMFFMSPKVLFEKI
KNIFLALITACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMAALANAGTATKGIDQIAS
RGGGGGARDLIGAKGLVSDNIASSGGAVGDNIASSGGAVGDNIAVSGAASTPTVTTTTASSSIANSMTKT
IGDDVRSDIVTPHASTTAVPQHSSINTTIPTSVSPNIKSTSLKEIIRDNQENEKEIDNTTRAQEKIKSSS
KVSGLIDYSFNLKEHDNPTGIKQIRENAEIRDKRVEVEKAWNELVASGGGRIRDQQSEETSEQRTNAEKK
WNEFVDSGVVTEIREIDNSVNNKLADKLDKSEKSKIEENKNIENNIKVYNTNTLPQEKVNNTDKSSGLID
YSFNLKEHDNPTGVKQIRENAEIRDKRVKVEKAWNELVASGGGRVKEQAGGKITERRANAEKVWDDLVKS
GVVKEKKDNSSNENS
 
Nucleotide Sequence: 3408 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c44427-41020 Rickettsia typhi str. Wilmington, complete genome
ATGGCATTATTCCCTCGTGGTATACTGATAGCATTAGTACTGAGCTTTGTCCTAAATTTAGGTCTAGTGA
CTAAAATTCATGCTAAAGATACTCTTGATAGCATTATAGATATTTTGAGTGGCTTAACTTGCGAAACACA
AGGTGTAGGTGATTTAATGCGTACTGAATTTTCACATACATGTATTGTCGCTCCGTTTTTTACTTTTGCG
GTAATGAATCTTGTATCTCCCGTTTTATACATGAATACATTTTTAAAGCTTAAAATAAATGACAGTGATT
TATTTAACGATAGTAATTTTGGGAATTTTCCCGGAGGTCAATGTACTCGTGAAAACAGAATTGATCCTAA
AAATCCAGAATTACATTTTGCTCTATGTAGTAATGCTAAATTAATTGTATCGCGTGCAAAATCAGTTACA
GAATCGGCACTTGCTATTGCTAAAGCCGTCTTAACATGGAGTGATCCTTGGGATGATATAAAGCAAGCGT
GGGAAAATAAAAAAAAGGAATATCATATTCCATATAGAGGTAAGCCTGGTGATGACGGTTTTGCATTTGA
TGTAGGCTTCCCTGTAATATATTGGAAAGTTATTCAAGATAGAGATAGAATATGTGTCTCAACAAAAGGG
TTTACAGGAGATGTGCCAGTCGGCTGTAAATATATGAAAGAGCCGTTTCCAAAATCCATATATAATAGTT
TTATTGATGTAGAAGATAAGAATTTTATTAAAGATTCAACAAATGACACACCTAGCGATCCTTTAGCTTT
AGTTTCCTGTAGTGCTGCAGGAGATGGGTGTTATCAAAAAGCTTATAATGCTTCAAAAACTGCAATAGTC
ATGACTTCTCCTCTTATAGAATGTATAAGGCAAATGATTGCTAGATTACTAATTAGTAAAGATGTTTGTA
GTTTTGATAATGTAGATCAAGTTGTGAATTTGGCATCAAGACAAGATAGTGCATTATTTCAGTTCCAAGT
AGGCATGCATAAAATAGTTACGGCTTTTTTAACTTTATATGTTATGTTTTTTGGTTTTAAGTTATTACTT
GCAGGTAAAGTGCCGCCAAAAAGTGAGTATATAAATTTTATATTGAAAATAATATTTGTAACTTATTTTT
CAATAGGAATTAATATAAATCCTTCTAATGGTTCTCAGTATGATCGGTTAGATGGAATGATTCAGTGGGT
GTTTCCTTTCTTACTTAACGGTATAAGCGGTTTAGCAAATTGGGTTATGAATGCTGCTCCGTCTGGTTTA
TGTAAATTTAATAATATTTCTTATGATAAAAGTGTTTCATATATTGCATTATGGGATGCATTAGATTGTA
GAGTTGCTCATTATTTAGGACTTGATATATTATCTACTTTACTTGTAGAAAATTCGTATCGAAGCCATGA
TTTTTTAAATTTTGATTTCTTTAGTTTTAGTGCCCCACCATATATTTATTTAATAATTCCAGCAATAATC
TCTGGTAATATGATGTTGGTATCACTTGCACTTTCTTACCCGTTACTGGTGATTTCTGTCGCTGCATTTA
TGGTTAATGCAACAATTATGTGTATGATATCTATAGTCATACTCGGTATTCTAGCTCCTCTTTTCGTGCC
TATGTTCTTATTTGCGTATACACGAAATTATTTTGATAGCTGGGTTAAGCTGATGATTTCATTCTTGCTA
CAGCCTATGGTAGTAGTCACGTTTATGATTACGATGTTTGCAGTATATGATTATGGCTTTTATGGTAAAT
GTCAATATAAGAGCAAGTTAATTCATAATAGCATAGAAGATAAAATGCAAGGTGGTATAAAATCTAAGAG
AGATGTTTTAATATTTTATATTAATAATGATTGGGATGACACATCACAATATCCTGATAAAGATTCAGTA
GAGAGTTGTAAAAATAGTTTAGGGTATATGTTAAATAACCCTATTAATACAGCATTTAACTTTGCAAAAG
ATAATATCAGTGAAATAGTTAATAGTAAACCTGGTGAGACCACTACTGATGAATTTCTTTCTAAATTTCA
GTTTTTATCAGGAGTTGTTTTGGGTCCTGGTATGTTTTTTATGTCGCCAAAAGTGCTTTTTGAGAAAATT
AAAAATATTTTTCTTGCATTAATTACTGCATGTTTTACATTGTATTTAATGTATAATTTTAGTAGTCAAC
TAGCTGAATTTGCTGCAGATATGACAGAAGGAGTTGCGCTTAATAATGTTGCTATCAAGCCACAAGCAAT
ATTTAAGGCAGCTATGGCAGCGCTTGCTAATGCTGGTACTGCAACTAAGGGTATAGATCAGATAGCAAGC
CGTGGAGGAGGTGGAGGTGCACGTGATTTAATTGGAGCTAAAGGATTGGTAAGTGATAATATAGCTTCAA
GTGGAGGTGCTGTCGGTGATAATATAGCTTCAAGTGGAGGTGCTGTCGGTGATAATATTGCTGTGAGTGG
AGCTGCGTCAACACCTACAGTAACAACAACTACAGCTTCGTCTTCAATAGCAAATTCTATGACAAAAACT
ATAGGTGATGATGTAAGATCAGATATTGTCACTCCTCATGCTTCTACAACAGCTGTTCCACAGCATTCTA
GCATTAATACTACTATTCCTACATCTGTATCACCTAATATTAAATCTACAAGTCTTAAGGAAATTATTAG
AGATAATCAAGAAAATGAAAAAGAGATCGATAATACTACGCGTGCACAAGAAAAAATTAAAAGTTCAAGT
AAAGTTTCAGGACTAATTGATTATAGTTTTAACTTAAAGGAACATGATAATCCAACAGGAATAAAACAGA
TAAGGGAAAATGCAGAGATTCGTGATAAACGTGTAGAAGTAGAGAAAGCATGGAACGAATTAGTGGCAAG
TGGTGGAGGCAGAATAAGAGATCAACAAAGTGAAGAAACATCGGAGCAACGTACTAATGCAGAAAAGAAA
TGGAATGAATTTGTTGATAGCGGTGTAGTAACTGAAATAAGAGAAATTGATAATAGTGTCAATAATAAAT
TAGCTGATAAACTTGATAAATCAGAAAAATCAAAGATAGAAGAAAATAAAAATATAGAAAATAACATTAA
AGTCTATAATACTAATACGTTGCCACAAGAAAAAGTCAATAATACAGATAAAAGTTCAGGACTAATTGAT
TATAGTTTTAACTTAAAAGAACATGATAATCCAACAGGAGTAAAACAGATAAGGGAAAATGCAGAAATTC
GTGATAAACGTGTAAAAGTAGAAAAAGCATGGAATGAACTAGTCGCAAGTGGAGGTGGAAGAGTAAAAGA
ACAAGCAGGAGGAAAAATAACAGAACGACGTGCAAATGCAGAAAAGGTATGGGATGATTTAGTTAAAAGT
GGTGTAGTAAAAGAAAAAAAAGATAATAGTTCTAATGAAAACTCTTAA
 Primer design