SecReT4
Protein ID: 51473246
T4SS name [ID]VirB [498]
Gene symbolvirB4a
Locus tagRT0033
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]44546..46963 [-]
Producttype IV secretion system ATPase VirB4
Component typeVirB4
UniProt IDQ68XX1
KEGG IDrty:RT0033
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 7e-68, Aligned region: 194..399
AAA_10 [PF12846], Evalue: 7.1e-37, Aligned region: 452..727
AAA_23 [PF13476], Evalue: 1.3e-05, Aligned region: 444..576
Protein Sequence: 805 a.a.     [Download]
>gi|51473246|ref|YP_067003.1| type IV secretion system ATPase VirB4 [Rickettsia typhi str. Wilmington]
MKLFRTRTAKELRSKQERPTSHFIPYRCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNA
LLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGAKSFFNELYISILY
KPDTGGAAIVEYFLKKLRQKSNKTAWENDMKEMKENLQEMSTRVINTFRSYGAKLLGVRQTQSGIYCEIL
EFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEVRSPFGKKYAGIISILEYGPNTSAGIFDGF
LQMPFEFVMTQSFVFANRTVAIGKMKLQQNRMIQSGDKATSQIVEINTALDMATSGDIGFGDHHLSLLCS
AKNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLG
KIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRG
AEIFIRALNGVYTVIDPGLKCNFNPLHLEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFR
LEKKDRRLSNVIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQRARVFGFDMTELLKDPVSLA
PVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAAKSSISD
TLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGIDAVVAKVNLEGMDNIISVL
SGRVETVILLDQIRDKYGNDPDKWLPIFYEAVKTL
 
Nucleotide Sequence: 2418 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c46963-44546 Rickettsia typhi str. Wilmington, complete genome
ATGAAGTTATTTAGAACTAGAACAGCTAAAGAATTAAGGTCTAAACAAGAAAGACCAACTTCGCATTTTA
TCCCTTATAGGTGTCATTGGGATAGTAATACTATTTTAACAAAAGATAATTCTTTATTACAAGTTATTAA
AATCAATGGATTTTCTTTTGAAACTGCCGATGATGAAGATTTAGACATTAAAAAGAATATCAGAAATGCC
TTGCTTAAAAATATGGCTTCTGGAAACATTGTTATGTATTTCCATACTATTAGAAGACGTAAAGCAGTAA
TATTTGACGATACAGAATTTACTTATGATCCTACCGTAAAAGTACCTAATGATTTTATTACTTATTTAGG
TGCAGAGTGGCGTAAGAAACATGCAGGTGCTAAATCATTTTTTAATGAATTATATATTAGTATTTTATAT
AAGCCTGATACTGGCGGTGCTGCTATAGTTGAGTATTTTTTAAAGAAGCTTAGACAGAAATCTAATAAAA
CTGCTTGGGAAAATGACATGAAAGAGATGAAAGAAAATCTTCAAGAAATGTCAACGAGAGTGATTAATAC
ATTCAGAAGTTATGGAGCAAAATTACTTGGAGTCCGTCAAACACAGTCAGGTATCTATTGTGAAATTTTA
GAATTTCTTTCATCTTTAATTAATTGCGGTGATTCACCAGGACCTATAGCATTACCGCGTGGTACTATTG
ATGAATATTTACCAACACATAGATTATTTTTTGATTCTCGTACTATTGAAGTCAGAAGTCCTTTTGGCAA
GAAATATGCTGGCATCATCAGTATACTTGAATACGGTCCTAATACTTCTGCGGGAATTTTTGATGGATTT
CTACAAATGCCTTTTGAATTTGTTATGACTCAAAGCTTTGTATTTGCTAATAGAACTGTAGCAATTGGTA
AAATGAAATTACAGCAAAATAGAATGATACAATCCGGTGATAAGGCGACTTCACAAATTGTTGAAATCAA
TACAGCACTTGATATGGCTACTAGCGGTGATATTGGTTTTGGAGATCATCATTTATCACTTTTATGTTCC
GCAAAGAATATTAAAGCTTTAGAAGATATATTATCAATGGCAGCAGTTGAGCTTTCTAATTCAGGAATTC
AGCCGGTGAGAGAAAAAGTGAACATGGAACCTAGCTATTGGGGTCAATTACCTGGAAATATGGATTATAT
AGTGCGTAAATCGACTATAAATACTCTTAATATGGCTAGCTTTGCTTCGCAACATAATTATCCACTCGGT
AAAATTAGAGATAACCATTGGGGAGAATATGTCACAGTGCTTGATACAACTTCAGGTACACCGTTTTATT
TTAATTTTCATGTTAGAGATGTGGGACATACTCTAATTATAGGTCCAACGGGTGCCGGTAAAACAGTGCT
TATGAACTTCTTATGTGCTGAAGCACAAAAATTCAAACCTCGTATGTTCTTTTTTGATAAAGATCGCGGA
GCAGAAATATTTATACGTGCTTTAAATGGAGTTTATACAGTAATTGATCCTGGTTTAAAATGCAACTTTA
ATCCTTTGCATCTTGAAGATACTAGTGAGAATAGAACGTTTATTTTAGAATGGCTTCGCGTACTTGTAAC
TTCTAACGGTGAAAGTTTAACTGCACAAGATAATAAAATCTTATCACAAGCTGTAAGTGGCAATTTTAGA
TTAGAAAAAAAAGACAGAAGGCTTAGTAACGTTATTGCATTCCTTGGTATTGATACACCAAATAGTTTAG
CAAGTAGGATTGCAATGTGGGTTGGTAAAGGTTCACACGCTAAGATATTTGATAATGAAATAGATGATAT
CGATTTACAAAGAGCAAGGGTATTTGGTTTTGATATGACGGAATTACTTAAAGATCCTGTAAGTCTTGCA
CCGGTATTGTTATATATTTTTCATCGTATTAATATATCTTTAGATGGACAAAAAACGATGATAGTACTTG
ATGAAGCATGGGCTTTAATTGACAATCCAGTATTTGCGCCTAAGATCAAAGATTGGTTAAAAGTGTTGAG
AAAATTAAATACTTTTGTTATATTTGCTACGCAGAGTGTAGAAGATGCTGCAAAAAGTAGTATTAGTGAT
ACGTTGATTCAACAAACAGCCACACAGATTTTTTTACCTAATTTAAAAGCTACGGATATTTATCGTAGTG
CATTTATGTTAAGTCAGCGCGAATATATTTTAATTAAAACTACCGATCCTACTACACGTTATTTTTTAAT
AAAACAAGGAATAGATGCCGTAGTTGCGAAAGTTAACTTAGAAGGTATGGATAATATAATTAGTGTTTTA
TCTGGCAGAGTTGAAACTGTAATATTGCTTGATCAAATTAGAGATAAATACGGCAATGATCCGGATAAGT
GGTTACCTATATTTTATGAAGCAGTTAAAACATTATAG
 Primer design