SecReT4
Protein ID: 51473247
T4SS name [ID]VirB [498]
Gene symbolvirB3
Locus tagRT0034
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]47136..47423 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDQ68XX0
KEGG IDrty:RT0034
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 7.8e-17, Aligned region: 8..90
Protein Sequence: 95 a.a.     [Download]
>gi|51473247|ref|YP_067004.1| type IV secretion system protein VirB3 [Rickettsia typhi str. Wilmington]
MSGTLASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGIMILFIAGALHLVAYIICFKEPRFIE
LYLNKMSRTSQCPNKFYYGANSYNI
 
Nucleotide Sequence: 288 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c47423-47136 Rickettsia typhi str. Wilmington, complete genome
ATGTCAGGAACATTAGCATCTGATCTTTTATTTGTAGGTTTAACTAGACCGCCGATGATATTTGGAGTAA
GTATTAAATTTGCAGCGTTAAATATGATAATGACTATGATAGTATTTATTTGGAATAACGGCATTATGAT
TTTATTCATTGCCGGTGCTTTGCATTTGGTAGCTTATATTATATGTTTTAAAGAGCCTAGATTTATAGAG
CTATATTTAAATAAAATGTCAAGAACTAGCCAATGTCCTAATAAATTTTACTACGGAGCAAATTCGTATA
ATATTTGA
 Primer design