SecReT4
Protein ID: 51473390
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0181
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]230866..231252 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDQ68XH7
KEGG IDrty:RT0181
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.4e-19, Aligned region: 24..115
Protein Sequence: 128 a.a.     [Download]
>gi|51473390|ref|YP_067147.1| hypothetical protein RT0181 [Rickettsia typhi str. Wilmington]
MLIFLEVKYMNFHNRKLDEELIDYNISLRILFTILSVAIIMVAFDSLATSVSDPVGDALCKLIKVFRGNT
AKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAIIILFKAPDIVNMVSSDNNSSNCGVS
 
Nucleotide Sequence: 387 bp     [Download]
>gi|51473215|ref|NC_006142.1|:230866-231252 Rickettsia typhi str. Wilmington, complete genome
ATGCTAATTTTTCTTGAGGTAAAATATATGAACTTTCATAATCGTAAATTAGACGAAGAATTAATCGATT
ATAATATATCATTACGTATATTATTTACTATTCTAAGCGTAGCTATTATTATGGTGGCTTTTGATAGTTT
AGCCACTAGTGTGAGCGATCCTGTAGGTGATGCATTATGTAAGTTAATTAAAGTATTTAGAGGCAATACT
GCGAAAGGTATAGCTGTTGTAGGTATAATTGTTTTAGGAATTCAAACATTAAGAGGAAAATTGCAGTGGG
AAGTAGCTTTAGTAGTAGTTACTGCAATAATTATATTATTTAAAGCACCAGATATTGTGAATATGGTGTC
AAGTGATAATAATAGCTCAAATTGTGGTGTTTCTTAA
 Primer design