SecReT4
Protein ID: 51473482
T4SS name [ID]VirB [498]
Gene symboltrbG
Locus tagRT0277
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]351539..352291 [-]
ProductVirB9-like conjugal transfer protein precursor
Component typeVirB9
UniProt IDQ8GB65, Q68X85
KEGG IDrty:RT0277
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.3e-60, Aligned region: 29..245
Protein Sequence: 250 a.a.     [Download]
>gi|51473482|ref|YP_067239.1| VirB9-like conjugal transfer protein precursor [Rickettsia typhi str. Wilmington]
MKPLIIFCTFIILTLDVFALTMSRPLGRDPRLRVMIYNPDDVFKFTGYYGYQASIELAKEEEIVSISMGD
TTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRTYFFELYAAETLDIRDPEMVFNVKFLYPDDENDNMSG
HMQTFSTALASPDLTHPEKYNFNYYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLV
NYRLAQDNPNMIILEQVFPKLAIRKGKKVTCVFNHSFKAY
 
Nucleotide Sequence: 753 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c352291-351539 Rickettsia typhi str. Wilmington, complete genome
ATGAAGCCACTAATAATATTTTGTACTTTTATAATACTGACATTAGATGTATTTGCTCTTACTATGTCAC
GACCTCTAGGTCGAGACCCACGTCTAAGGGTTATGATTTATAACCCTGATGATGTTTTCAAATTCACAGG
ATATTATGGGTATCAAGCAAGTATAGAACTAGCAAAAGAGGAAGAAATAGTCAGTATTTCTATGGGAGAT
ACTACATCATGGCAAATAGTACCTGCTGGTCATAGAATTTTTATTAAACCTATGGAACCAGATGCTACTA
CTAATATGACTTTAATTACTAATAAACGGACTTACTTCTTTGAACTATATGCAGCGGAAACTCTTGATAT
ACGTGATCCTGAAATGGTGTTTAACGTAAAGTTTCTTTATCCGGATGACGAAAATGACAATATGAGCGGT
CATATGCAAACTTTTTCTACAGCTCTAGCAAGCCCTGATCTTACTCATCCTGAAAAATATAATTTTAATT
ACTATATTAGCGGAAGTGAAGAAATAGCTCCTATTAAGATCTTTGACGATGGAGAATTTACTTATCTACA
ATTTAGAGATAAAAACGCCGAAATTTCTGGTATTTTTGCTGTAGACGATTCACTGCGAGAATCTTTAGTA
AATTATCGTCTTGCTCAAGATAATCCTAACATGATCATCCTTGAACAAGTTTTCCCTAAGCTTGCTATAC
GTAAAGGTAAAAAAGTAACATGCGTATTTAATCATTCTTTCAAAGCATACTAA
 Primer design

Protein ID: 51473486
T4SS name [ID]VirB [498]
Gene symbolvirB9
Locus tagRT0281
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]354387..354863 [+]
ProductVirB9 protein precursor of the type IV secretion system
Component typeVirB9
UniProt IDQ68X81, Q8GB64
KEGG IDrty:RT0281
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.7e-33, Aligned region: 46..151
Protein Sequence: 158 a.a.     [Download]
>gi|51473486|ref|YP_067243.1| VirB9 protein precursor of the type IV secretion system [Rickettsia typhi str. Wilmington]
MTIVRFYFLAFLLLSGFTAQRACPVVDDSFNSISNNYVDDLSLTKDNRIRTYIYNPNEVYLLVLHFGFQS
HIEFAKNEEIQNIILGDAYAWKITPLANRLFIKPLEKDIRTNMTIITNKRTYEFDIASTELMIGNERDLV
YVIKFYYPKKNSNYMARF
 
Nucleotide Sequence: 477 bp     [Download]
>gi|51473215|ref|NC_006142.1|:354387-354863 Rickettsia typhi str. Wilmington, complete genome
ATGACAATAGTTAGATTTTATTTTTTAGCTTTTCTATTATTAAGTGGTTTTACAGCACAACGTGCATGTC
CGGTTGTAGATGATTCATTTAATAGTATTAGTAATAATTATGTAGATGATTTATCTTTAACTAAAGATAA
TAGGATCAGAACTTATATATATAATCCAAATGAAGTTTATTTATTAGTTTTGCATTTTGGCTTTCAATCG
CATATAGAATTTGCTAAAAATGAAGAAATTCAAAATATAATTCTTGGGGATGCTTATGCTTGGAAAATAA
CCCCTCTGGCAAATAGGTTATTTATTAAGCCTCTTGAGAAAGATATTCGTACAAATATGACGATTATAAC
TAATAAAAGAACATATGAATTTGATATCGCTTCTACTGAACTTATGATAGGTAATGAAAGAGATTTAGTA
TATGTAATTAAATTTTACTATCCTAAGAAAAATAGTAATTACATGGCAAGGTTTTAG
 Primer design