SecReT4
Protein ID: 51473483
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0278
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]352293..352991 [-]
ProductVirB8-like protein of type IV secretion system
Component typeVirB8
UniProt IDQ68X84, Q8GLW0
KEGG IDrty:RT0278
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-17, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|51473483|ref|YP_067240.1| VirB8-like protein of type IV secretion system [Rickettsia typhi str. Wilmington]
MDQLTNAIKEYIKSGEYFIDARKWYNFKYILPLSHRSFLLLTCTIFTLLLTLIGVNINILLPIQKKVGYL
IKDDSEKQATITNTKYSTLANPYISVANIMLQNYVKQREKYNYDTLKEQFTFIKNASTSIVYMQFANFMN
IDNSLSPVIRYQKLYRRSINIISINNINNNEATVTFESLAQNNTGEILENMLWEAKIGFIMDSISTSTLH
NMPFHFIVTSYKLKLLRNKNQQ
 
Nucleotide Sequence: 699 bp     [Download]
>gi|51473215|ref|NC_006142.1|:c352991-352293 Rickettsia typhi str. Wilmington, complete genome
ATGGACCAATTAACAAATGCAATAAAAGAATATATAAAATCCGGTGAATATTTTATTGATGCGAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTTTTCTACTCTTAACATGCACAATTTTTAC
ATTATTATTAACATTAATTGGTGTAAATATCAACATATTGTTACCAATACAGAAAAAGGTAGGTTATTTA
ATAAAAGATGATTCAGAAAAACAAGCTACCATTACTAATACTAAATATTCAACATTAGCAAATCCTTATA
TTTCTGTTGCAAATATTATGCTTCAGAATTATGTAAAACAACGAGAAAAATACAATTATGATACATTAAA
AGAACAATTCACTTTTATTAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACTCATTATCACCTGTCATACGATATCAAAAGCTATATAGACGCTCAATTAATATAATATCAA
TTAACAATATCAATAATAACGAGGCAACTGTTACTTTTGAATCATTGGCACAAAATAATACTGGTGAAAT
CTTAGAAAATATGCTATGGGAAGCAAAAATTGGATTTATAATGGATTCTATCAGTACAAGTACATTACAC
AATATGCCGTTCCATTTTATAGTTACTAGTTACAAGCTAAAATTATTAAGAAATAAAAATCAGCAATAA
 Primer design