SecReT4
Protein ID: 51473485
T4SS name [ID]VirB [498]
Gene symbol-
Locus tagRT0280
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]353669..354400 [+]
ProductVirB8-like protein of the Type IV secretion system
Component typeVirB8
UniProt IDQ68X82
KEGG IDrty:RT0280
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.3e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|51473485|ref|YP_067242.1| VirB8-like protein of the Type IV secretion system [Rickettsia typhi str. Wilmington]
MNNIFGFFKSSNNTQSGSGGKQNHESIKSTNPLKISQNWYEERSDKLIVQRNLLIILIILLTIFMVISTL
VIAFVVKSKQFDPFVIQLNSNTGRAAVVEPISSSTLTVDESLTRYFIKKYITARETYNPVDFATIARTTV
RLFSTSAVYYNYLGYIRNKDFDPTLKYKADNTTFLVIKSWSKIAEDKYIVRFSVNETSGSQLVYNKIAVV
SYDYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|51473215|ref|NC_006142.1|:353669-354400 Rickettsia typhi str. Wilmington, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACACGCAAAGTGGTTCAGGAGGTAAACAAAATC
ATGAAAGTATTAAATCAACTAATCCTTTAAAAATTAGTCAGAATTGGTATGAAGAGCGATCTGATAAATT
AATTGTTCAGAGAAATTTGCTGATCATATTAATAATACTACTAACCATTTTTATGGTTATATCAACTTTG
GTCATAGCATTTGTAGTAAAGTCTAAACAGTTTGATCCTTTTGTGATCCAGCTTAATAGTAATACTGGAC
GTGCTGCGGTTGTAGAACCTATTTCATCATCGACGTTAACTGTAGATGAGTCTCTTACAAGATATTTTAT
AAAGAAATATATAACAGCACGTGAAACATATAATCCAGTTGATTTTGCAACGATAGCTCGTACGACAGTC
AGATTATTTTCAACAAGTGCTGTTTATTATAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGCAGATAATACTACATTTTTAGTAATAAAGTCATGGTCTAAAATCGCAGAAGATAA
ATACATAGTTAGATTTTCTGTAAATGAAACATCAGGAAGCCAATTAGTTTATAATAAAATCGCGGTAGTA
AGTTATGATTATGTGCCTATGCAATTAACAGATTCAGAACTTGACATAAATCCCGTAGGGTTTCAAGTTA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design