SecReT4
Protein ID: 51473487
T4SS name [ID]VirB [498]
Gene symbolvirB10
Locus tagRT0282
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]354946..356397 [+]
ProductVirB10 protein of the type IV secretion system
Component typeVirB10
UniProt IDQ8GLV9, Q68X80
KEGG IDrty:RT0282
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.7e-37, Aligned region: 193..346
TrbI [PF03743], Evalue: 3.7e-37, Aligned region: 401..471
Protein Sequence: 483 a.a.     [Download]
>gi|51473487|ref|YP_067244.1| VirB10 protein of the type IV secretion system [Rickettsia typhi str. Wilmington]
MVAEQNNNNNTDSLSGTDLPEVQRELSKVSVSFNKNIAIVVVICAILIYIFYTLFFDMRKEEIPETKIPS
NIVTPVTDVNDIIPEIPKLPDPPKLERPTVLQPPPPPPPVVEVPPVLPPISIEGNKEQTLQLPPVSLPTT
SSTLVESDAEKQRREAKRKSAIVLVGGVEPKKTPEQITEAVTFKDRGDMFLLLGRGKLIDAVLETGINSD
LGGEIRAIISRDVFSEKGKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRVDLTNGYTIEFDSPAVDNL
GRPGLQGRVDNKYKEQFANAVLQSGFNIGLAKILDKLVPPPIDSQAAATNSATATQILNIAQTISSNTAI
DVNTRIVTICTNILAAITDKTSIAYTTMTQACATAQNASSANTSEQRLQTLVQAVNTAASNLLTTTSIAS
TPTQAQQASTQAFTDVTNVVQNMITQQHFKPTTTVNQGTPIRIYVNKDYKFPRTVLLKSKVMK
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|51473215|ref|NC_006142.1|:354946-356397 Rickettsia typhi str. Wilmington, complete genome
ATGGTTGCAGAGCAAAATAACAATAATAATACCGATTCTTTATCAGGTACAGACTTACCTGAGGTACAAA
GGGAATTATCTAAAGTTTCGGTTAGTTTTAATAAGAATATTGCAATAGTAGTGGTAATTTGTGCTATTCT
TATATATATCTTTTATACTCTTTTTTTTGACATGAGAAAAGAAGAAATACCTGAGACTAAGATACCGAGT
AATATTGTAACGCCTGTTACGGATGTTAATGATATTATTCCAGAGATCCCAAAGTTACCAGATCCACCTA
AACTTGAGAGGCCAACAGTGCTTCAACCACCGCCTCCTCCTCCGCCAGTAGTAGAAGTTCCGCCTGTTTT
ACCTCCGATTTCTATAGAAGGGAATAAAGAGCAGACACTTCAATTGCCACCGGTGTCGTTACCTACGACC
TCATCAACGTTAGTTGAGAGTGATGCAGAGAAGCAACGCCGTGAAGCAAAACGGAAATCAGCTATAGTGT
TAGTGGGTGGTGTAGAGCCTAAAAAAACACCAGAACAAATTACAGAAGCGGTGACATTTAAAGATCGTGG
TGATATGTTTTTGTTGCTTGGACGCGGTAAGTTAATCGATGCAGTGCTTGAGACAGGAATAAATAGTGAT
CTCGGTGGTGAAATAAGGGCAATTATTAGTAGAGACGTATTTTCTGAAAAAGGTAAAGTGATATTAATAC
CAAAAGGGTCAAAAATATTCGGTAAATATGCAACTTCAACTTCATCAGATAGTTACGGTAGGGTTTCTAT
CATATGGGATCGAGTCGATTTAACTAATGGTTATACCATAGAATTTGACTCACCTGCAGTTGATAATTTG
GGTAGACCTGGATTACAGGGGAGGGTTGATAATAAATATAAGGAACAATTTGCAAATGCCGTATTACAAT
CTGGCTTTAATATAGGTCTTGCTAAAATCCTAGATAAGTTAGTCCCACCTCCTATAGATTCACAAGCAGC
GGCTACCAACAGTGCTACAGCAACACAAATATTAAATATAGCTCAAACTATTTCGTCTAATACTGCTATT
GATGTAAATACTAGGATAGTTACAATTTGTACTAATATACTTGCTGCTATTACTGATAAAACTTCTATTG
CTTATACTACTATGACTCAAGCATGTGCGACAGCACAAAATGCTTCTTCAGCCAATACTTCTGAACAGAG
ACTTCAAACATTAGTACAGGCAGTTAATACAGCAGCTTCAAATTTGCTTACTACTACATCTATTGCCTCG
ACTCCTACACAAGCACAACAAGCTTCTACGCAAGCTTTTACTGATGTGACTAATGTTGTACAAAATATGA
TAACTCAACAGCATTTTAAGCCTACGACAACGGTTAATCAAGGTACACCGATTAGAATATATGTTAATAA
GGATTATAAATTTCCAAGAACCGTTTTATTAAAATCGAAGGTAATGAAATGA
 Primer design