SecReT4
Protein ID: 51473488
T4SS name [ID]VirB [498]
Gene symbolvirB11
Locus tagRT0283
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]356394..357398 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ68X79, Q8GLV8
KEGG IDrty:RT0283
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-93, Aligned region: 13..312
Protein Sequence: 334 a.a.     [Download]
>gi|51473488|ref|YP_067245.1| type IV secretion system ATPase VirB11 [Rickettsia typhi str. Wilmington]
MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEAWVEKRGDIYSKQIPELDSEHLLALGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMNLTLDEYAQMGAFDNTATESLVDEDADIL
NNFLAEKKIKEFIRYAVISKKNIIISGGTSTGKTTFTNAALTEIPAVERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILSVVDIVVQLKRASGGKRYVSEVYYKKNKNSESML
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|51473215|ref|NC_006142.1|:356394-357398 Rickettsia typhi str. Wilmington, complete genome
ATGAATGAAGAATTTGCAGCCTTAGAGACATTTTTACTACCTTTTAAAAATTTATTTGCTGAAGATGGTA
TTAATGAAATTATGGTTAATAAGCCTGGAGAAGCATGGGTTGAAAAAAGAGGAGATATATATTCTAAGCA
AATACCAGAACTGGATAGCGAACATCTACTTGCATTAGGGCGTTTAGTTGCTCAATCTACAGAACAGATG
ATTTCGGAAGAAAAACCGCTCCTTTCAGCAACTTTGCCAAATGGCTACCGTATCCAAATAGTCTTTCCTC
CTGCGTGTGAGATAGGACAAATCATTTATTCTATAAGAAAGCCTAGTGGTATGAATTTAACTTTAGATGA
ATATGCTCAAATGGGAGCATTTGATAACACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGATATTTTA
AATAATTTTTTAGCTGAAAAAAAAATTAAAGAATTTATTAGGTATGCAGTTATTTCAAAAAAAAATATCA
TAATTAGTGGTGGGACTTCAACTGGTAAAACTACTTTTACTAATGCCGCACTTACTGAAATACCTGCAGT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAAGTTGTACTATCAAGTCATCCTAACAGAGTACATTTA
CTTGCTTCTAAAGGTGGGCAGGGGCGTGCAAATGTTACTACACAAGATTTAATAGAGGCATGTTTGCGTT
TAAGACCGGATAGAATTATCGTCGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCAGGTTCAATATCAACATTGCATGCTGATAGTCCTGCTATGGCTATTGAACAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCACCTGAAGAAGTAAAGAAGTATATTTTAAGTGTTGTAG
ATATTGTTGTGCAGTTAAAACGTGCTAGTGGTGGGAAAAGATATGTTTCAGAAGTGTACTACAAAAAAAA
TAAGAATTCTGAATCTATGTTATAG
 Primer design